SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013803 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013803
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily vWA-like 4.9e-38
Family Integrin A (or I) domain 0.00081
Further Details:      
 
Domain Number 2 Region: 189-348
Classification Level Classification E-value
Superfamily Fibronectin type III 2.65e-21
Family Fibronectin type III 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013803   Gene: ENSTNIG00000010873   Transcript: ENSTNIT00000013998
Sequence length 381
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:2301269:2303816:-1 gene:ENSTNIG00000010873 transcript:ENSTNIT00000013998 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGDVLFLLDSSGSVSSYEHSRMLAFLSELLQPFSLGEDQVRVGVLQVGTEPRLEFGFDAH
ATQSSLQGSLRNIKPLRGDTNTVEALKVAQERVLRPGVPGGARAGLPRVLVWLTDGVNPG
DISGPMAELREEGVAVLVVSTGHSNYLVLREIVTAPVENHLHFVDIDDMSIITDDLRDAI
IELIRAERLNVRDISTNSASLHWRPVLAGMRGYYEVRFAPLPTKVPGASSTAKLTGLKPD
TTYTVTLIPESNEHTFNALTTTFTTKPEVLSPVVVTVTESGATSVRLSWGPLQPQTVRDY
YIEYSALPRGELRTATVDRTQNSTLLRRLQPGTTYLVTVTARHASGKEKAMSVKVCTEEG
KGADLRGMIHSLRRSANPAQP
Download sequence
Identical sequences H3CZW7
ENSTNIP00000013803 ENSTNIP00000013803 99883.ENSTNIP00000013803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]