SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013814 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013814
Domain Number 1 Region: 17-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.9e-46
Family Laminin G-like module 0.0004
Further Details:      
 
Domain Number 2 Region: 485-683
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-38
Family Laminin G-like module 0.000000362
Further Details:      
 
Domain Number 3 Region: 275-486
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-32
Family Laminin G-like module 0.00079
Further Details:      
 
Domain Number 4 Region: 217-252
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000171
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013814   Gene: ENSTNIG00000010884   Transcript: ENSTNIT00000014009
Sequence length 705
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:2432256:2454106:-1 gene:ENSTNIG00000010884 transcript:ENSTNIT00000014009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CSSHPCLHGGTCEYQGGEFSCKCPAGRGGTVCEKVVKYFIPSFGGQSYLAFQTMSAYHTV
RIAMEFRPSDMNGILLYNGQNGKKDFISLALVNGRVELRFNTGSGTGTLVSKVQVNQGRW
HQLVVTRNRRSAVLSVENEPHVEGESPRGTDGLNLDTNLFIGGVPPELKDVAREQTAVAT
GLVGCIRLLDVNNRVLNLQENGGDSLYGSGVGECGNNPCQPNPCKNGATCEVKEAEMFHC
KCSRGFWGPTCADVHDPCEPNRCHPSSQCQALPEGGYKCECPMGREGRHCEKVAERSGVY
MPLFSGDSYVELKGLQRYGHDLRQKVSMTVVLMANDSNGLIFYNGQKSDGKGDFISLSLH
DGILEFRYDLGKGPATIRSREPIRLNVWNTINLERNRKGEIMVNKKDPVRGEAPNLHVDL
NLKESLFVGGAPDYSRLARAAALTEGFKGTIQKIILMGTPVLREDNVLRSSNVATFQEHP
CAQEPCHNGGQCNPQLDTYECVCLSGFSGGHCQSTIYEKSAGETEAIAFDGRTFIEYHNA
VTKSEKALLVNKFELSIRTEATQGLVLWSGKGVERSDYIALAIVDGHVQMTYDLGSKPVV
LRSSVRVDSNRWIRIKASRALRDGSLQVGNEAPVTGSSPLAATQLDTDGALWLGGLEELA
VARRLPKAYSTGFVGCIKDVVVDGVELHLVEDALNSPQILQCPAA
Download sequence
Identical sequences H3CZX8
ENSTNIP00000013814 99883.ENSTNIP00000013814 ENSTNIP00000013814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]