SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013825 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013825
Domain Number 1 Region: 477-750
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.54e-67
Family Ankyrin repeat 0.00017
Further Details:      
 
Domain Number 2 Region: 106-184
Classification Level Classification E-value
Superfamily RING/U-box 1.92e-23
Family ZZ domain 0.0075
Further Details:      
 
Domain Number 3 Region: 191-266
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 4.71e-23
Family Mib/herc2 domain 0.001
Further Details:      
 
Domain Number 4 Region: 49-119
Classification Level Classification E-value
Superfamily Mib/herc2 domain-like 2.35e-22
Family Mib/herc2 domain 0.00085
Further Details:      
 
Domain Number 5 Region: 936-991
Classification Level Classification E-value
Superfamily RING/U-box 0.000000707
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013825
Domain Number - Region: 870-912
Classification Level Classification E-value
Superfamily RING/U-box 0.0216
Family RING finger domain, C3HC4 0.022
Further Details:      
 
Domain Number - Region: 790-825
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0795
Family Ankyrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013825   Gene: ENSTNIG00000010895   Transcript: ENSTNIT00000014020
Sequence length 996
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:2952964:2972899:1 gene:ENSTNIG00000010895 transcript:ENSTNIT00000014020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FQPPVTPDLFPETSLVPALTSTSSSRASSAARSRLLRSASRPGPVGGSMEVGMRVVRGLD
WKWGNQDDGEGHVGTVVEIGRQGSTTTPDKTVVVQWDSGTRTNYRTGYQGSYDLLLYDNA
QIGVRHSNIICDSCKKHGIMGMRWKCKVCFDYDLCTQCYMNNKHDLSHAFERYETAHSQP
VSLAPRQNLPRIILKGIFQGVKVVRGPDWDWGNQDGGEGKVGKVVDIRGWDNESGRSVAS
VTWSNGTTNVYRMGHKGKVDLKYVSDGQGGFYYKDHLPKLGEHAELQRQESADGHSFQQG
DKVKCLLEVDILRQMQEGHGGWNPKMAEYICRIGTVHRITDRGDVRVQYSNNIRWTFHPG
ALTKVNTFGVGELVQVLEDMESVKRLQAGHGEWTDSMAPVLGQVGKVLKVYADGDLRVAF
GAQTWTFNPACLSAQPVEVDANLMTAENPSEPGSTVISVLEKLLSQSTEQDNPSRLVIEA
AHGSATKVRELVQKYPDKVDIKNQGKTALQVAAHQGHMEVVKALLQANGSIEIKDEDGDT
ALHYTAFGNQAEIARLLLSKGANVNLLNNSMCTALHIAVNKGFTDLVRVLTEHSADVNLQ
DSYGDTPLHDAIAKDFRSIIEILVLVPNIDFTQQNHRGFNLLHHAALKGNKLATEKILGR
ARQLVDVKKEDGFSALHLAALNNHRDVAEILIKEGRCDINIRNNRNQTPLQLAVTQGHTD
LVQLLVAEGADVNMEDEDGDTAMHVALLRPQLANVTLSPAMETGSTDHPQLNASGLLGNT
EISVGAAIACFLAQEGADINYANHKGKSPLDLVADGGTLQLLKSFSEKHRLQRLQAITCG
QGLSSSSLRRVHTTPNTMTNLVLPTPPGPSECLICSELALLVLFCPCQHSVACQECAHRM
KKCIKCQVTITKKIRQDQTEVDCSPSTENSEQHNLLEQLQSRYRQMEERITCPICIDNHI
KLVFQCGHASCIECSAALKTCPICRQTIRERIQLFV
Download sequence
Identical sequences H3CZY9
ENSTNIP00000013825 99883.ENSTNIP00000013825 ENSTNIP00000013825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]