SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013830 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013830
Domain Number 1 Region: 6-162
Classification Level Classification E-value
Superfamily RUN domain-like 6.02e-30
Family RUN domain 0.0014
Further Details:      
 
Domain Number 2 Region: 731-834
Classification Level Classification E-value
Superfamily PH domain-like 7.08e-17
Family Pleckstrin-homology domain (PH domain) 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013830   Gene: ENSTNIG00000010900   Transcript: ENSTNIT00000014025
Sequence length 982
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:3034729:3043146:-1 gene:ENSTNIG00000010900 transcript:ENSTNIT00000014025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LMDELKVKDRILENISLSVKKLQSYFAACEDETPAIRNHDRVLQRLCEHIDHALLYGLQD
ISCGYWVLVLHFTRREAVRQIDELQHIATNLGRSRAWLYLALNESSLESYLRLFQENQTL
LHKYYFKNSLVCSHDHLALFLTLVSGLEFIRFELEMDVPYLDVAPYMPEYYKPHNLLDFE
ERLPSSDSLSLHSFTSLTSTNLEWDDSAIAPSSEDYDFGDIFPVLQSLPSADWEEGEMTD
QASCPPSSSSDPQTVISDTASPTFRHNPFNGDSDTNTTNTSADVTPVHLACRHDSAVGEE
MENGVTVLEVIRMARRRKPAKKRRGKGSTDSSSSIHNSVSSEHMEIGSSPVASEDMDLMD
CTVIQVDAEAVLRRNRGGSEKVGGEEDGEEALLRLPEMKDSSMDTVGQPLCDVMDRLNGA
LDKEETWGHKEEPPDPLPGEKTASPVSPNSDVLQASPASADVRCFTSFSPDATSPGGGHD
DSAEPGQSQAPSGGPKGAGEAEAAAGQESDVRDWEQDTEVGQDTDQNRITGEGKETQEDE
LNPSESSHPAEFRVDNNHLLLLMIHVFRENEEQLFKMLRMSTGHMEGDLQPLYLLLTDCY
IYLLRKGAADKPYTVEDAVSYNELDYLSVGLDQQTVTVVCINRRRKFLLDTADASLTLWF
LSILKSAMVKGCREPPYPSVLTDATMEKLSLTKFVSQESQCEVSEVCIHLYSLVHWEDPL
DMTQGCSPTSGVSFSAKEGTLQYRAGTTYLGKELWKSCYLVLSSGILYLYAERTDVTPLL
SVSMGGEHCGGCRRSNSTERPHAFQVILTERAPLELSANDEQEMAEWMQLLCQSVSKGVI
PQGVAPTPCIPCCLVVTDRKLLTCHQDCQTSFFRSLGSVDICDVTAVRLEAKKQYCVIEF
ASDRAQFLPPWVLYFSGCRERDRLLEALGNAWKAIFQVDLPHRELLDASLQKRCSEALVL
MSNAWQRADSLARVRAQREPWC
Download sequence
Identical sequences H3CZZ4
99883.ENSTNIP00000013830 ENSTNIP00000013830 ENSTNIP00000013830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]