SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013882 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013882
Domain Number 1 Region: 382-524
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-39
Family Third domain of FERM 0.0000117
Further Details:      
 
Domain Number 2 Region: 277-383
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-33
Family Second domain of FERM 0.00000651
Further Details:      
 
Domain Number 3 Region: 194-277
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.89e-26
Family First domain of FERM 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013882   Gene: ENSTNIG00000010952   Transcript: ENSTNIT00000014077
Sequence length 948
Comment pep:known_by_projection chromosome:TETRAODON8:14:6718048:6735286:1 gene:ENSTNIG00000010952 transcript:ENSTNIT00000014077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTEASSETEVKEKAEESAAQTDQSEEATVETQEVANAEEEVKEKEKEGKGISRYLPTWL
KKQKSQSQASEKEETQEGEKPAPEVNGHAEDVEEKEPEKSEQVKERREEPDTNTSAGAEV
LVESDSRGLHDMTFVSAVLPDQLIRRDNNRWKIQSEQDSQEKKRQTTSAYQGRKEGQTSI
FQSPLRLVKKGKMKLVVCRVNLLDGTDFTCEVEKRARGQYLFFKVCEHLNLMEKDYFGLT
YRDSHDQKCWLDPTKEIKKQICNNNWQFSFNVKFYPPDPSLLTEDITRYLLCLQLRDDVA
TGRLPCSFVTHALLGSYTLQAEFGDYEPDQPRPLEHISQWRFAPNQNKEMEEKILELHKS
HRGMTPAQADTQFLENAKKLSMYGVDLHHAKDSEGVDIMLGVCSNGLLVYKDRLRINRFA
WPKILKISYKRNNFYIKIRPGETEQFESTVGFKLQNHRSAKRLWKVCVENHSFFRLNAPE
PPPKARFLTLGSKFRYSGRTQAQTRLASSLIDRPAPKFERTSSKRISRSLDGAPVISITD
TDGDVAENGHMTFSVITDSISEKAFPQKVKRFPSSPLQSPLRVHRDNIYVRHSNLMLEDH
DKTQEEVLKHQASISQLKRSFMEAPPPSPPQLNQWEKRLTSSPATIRFQQQQVTTEVEIE
ETVVVQEVSKIPKPEGDAAPVSSPSEQEAQMLEPAKAPRKESVSSESESEEEAEYHPNVS
VSVSHTQILSEPVTDASAAAAEVGQPVEATEEAEAGSADVPEEAPNTEALSAGGAPTTAP
APVEEEEQPKMNGEASLAETELRPQVICCSEPPVVKTEMVTISDTFAAQKTEIATKEVPI
VHTETKTITYEAAQLDGNGDSEPGVLMTAQTITSESLCTTTTTHITKTLKGGLSETRIEK
RIVITGDCDIDHDEALAQAIKEAKEQHPDMSVTRVVVHKETELTEEED
Download sequence
Identical sequences H3D046
99883.ENSTNIP00000013882 ENSTNIP00000013882 ENSTNIP00000013882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]