SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013899 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013899
Domain Number 1 Region: 431-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000732
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 2 Region: 315-356
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000672
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 3 Region: 263-397
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000392
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 394-435
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.017
Further Details:      
 
Domain Number 5 Region: 470-514
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family EGF-type module 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013899
Domain Number - Region: 165-312
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00706
Family Growth factor receptor domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013899   Gene: ENSTNIG00000010969   Transcript: ENSTNIT00000014094
Sequence length 689
Comment pep:known_by_projection chromosome:TETRAODON8:14:6874574:6880350:-1 gene:ENSTNIG00000010969 transcript:ENSTNIT00000014094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAWFTFTIAFSTTLISQVVGSGVFELQLHEFKNHQGLLANGNACKPQCRTYFRICLKNY
QAVVLPGDCIFGSTMTAVLGTNSFSAKDGGASPIQIPFNFGWPGSFSLIIEAWHSPYENL
PVDSSNQDFLISLFAIRSQLAVGTDWAQDALTVKQTELRYSYRFICNESYYGESCSKKCT
PRNDRFGHYTCNRDGQLSCLPGWKGKYCEEPICLEGCSERNGNCSKPGECVCREGWQGTF
CDECKKYPACKHGTCALPWQCNCKEGWGGVLCDQDLNFCTHHHPCLNGATCMNTGQGSYT
CTCLPGFTGVNCELEMQECDSNPCRNGGICTNLETGYMCTCPQGFEGSHCEHSLLTCADL
PCFHGGKCGEKDNGRSYMCNCPHGYTGLNCEKRVDKCTSLPCANGGQCLLHGSMRMCSCR
AGFTGQRCEININECAGNPCLNSGTCQDRINDYTCTCPPGYGGRNCDRILDECSTHLCLN
GGRCTGGGGPGRPSPTCTCASGFTGPQCEFFAAVTSPVTKEREAPKGFQWAAVSLAVGLV
ALLVLLCMVGLALRHIHRQAQRERAETETMNNLSNIQRDNLIPASQLKNTNQKVSLEVDC
DMEKSNFIHKNYHLDPYNSKSKEFKDEKSEEDKSLIYDKCLEDKMPLNRMYSEKPECRIS
TICSSRDSMYQSVFVIAEERRECVIATEV
Download sequence
Identical sequences H3D063
ENSTNIP00000013899 ENSTNIP00000013899 99883.ENSTNIP00000013899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]