SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013955 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013955
Domain Number 1 Region: 222-384
Classification Level Classification E-value
Superfamily vWA-like 3.2e-25
Family Integrin A (or I) domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013955   Gene: ENSTNIG00000011022   Transcript: ENSTNIT00000014150
Sequence length 1059
Comment pep:known_by_projection chromosome:TETRAODON8:19:2608839:2637779:-1 gene:ENSTNIG00000011022 transcript:ENSTNIT00000014150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IKEWTKQMQKELITLIDTASGMKHLVQIYHKHSPHFTVETNNAQELVVTAAGNIEKLLAK
RSEALKKLAEEAETFQMKHKWRDDSEANKIVYYNAKEDVSTTPEFNQTDGKKNRYVPDDF
EMDDDFKRLVSYNTTAVHIPTDIYEGSTIILNELNWTEALEDVFRKNKEEDPSLLWQVFG
SATGLARYYPASPWMDISNSANKIDLYDVRRRPWYIQGAASPKDMLILVDASGSVSGLTL
KLIQISVSKMLETLSDDDYVNVVYFNDKAKYASCFENLVQANVRNKRMLKKAVQNITAKG
TTNYSGGFELAFEQLAQMNVSRANCNKIIMLFTDGGEEKAEEIFKKYNPNQEVRIFTFSV
GQHNYDKGPIQWMACANKGYYYEIPSIGAIRINTQEYLDVLGRPMVKDHKKAKKVQWTNV
YLDALELGLVITGTLPVFNKTNTGTKAPKYQNQLILGVMAVDVSLEDIKRLTPRFTFGPN
GYYFAIDPNGYVLLHPNLQPLTAKFNEPVTLDFLDAELENDIKVEIRKQMIDGLMGDYTI
STLVKSQDERYIDLGQRTYTFAPVKGTDYSLALVLPQYSKHYIKANIGDTITQAKFSESL
LADKFDEYGYTFIAPRMYCKDLAPPEKNQNNTEFLIEFNKYIDIETPNNPLCNAKLVNRM
LLDAGITSELIKIWKRSELQNGVIARFVTTDGGITRVYPKSAGLSWQEDAETYESSFYKR
SLDNNLYIFTPSPYSGENSSDDSVLVSRAVDITIGDSTLKPAVVGVKLDISTWMTSFINT
TWRMNCSDEICGCQRNHPYVDCVLLDDGGFLVMSNKDQDLSQIGHFFGTIDPVLMRTLVN
ASLFTFKKTLDYQFALRPAERQSKCSCAGPTIRQYVVPTVADILNVGWWATAAAWSILQQ
LLLSFTFPNFLEAAKMQDEVSDAMLKEVCITEQTQYYFENNQLSFSGNIDCENCTRIYHA
EKLPDTNLVFIISDAKLTCSSCKSKKLIQEEQQSDGPDPCEAARNPRYRKGPDICFDSTE
NEDDPDCGGASGLSPSSWLMVALQLALFWVLTGSRHHAM
Download sequence
Identical sequences H3D0B9
ENSTNIP00000013955

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]