SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013957 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013957
Domain Number 1 Region: 3-483
Classification Level Classification E-value
Superfamily Sema domain 1.83e-187
Family Sema domain 0.0000000000000997
Further Details:      
 
Domain Number 2 Region: 479-530
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000366
Family Plexin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 546-619
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000119
Family I set domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013957   Gene: ENSTNIG00000011024   Transcript: ENSTNIT00000014152
Sequence length 813
Comment pep:known_by_projection chromosome:TETRAODON8:19:2688790:2702144:-1 gene:ENSTNIG00000011024 transcript:ENSTNIT00000014152 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMLESSNLVTFDGLANSSSYDTFLLDEERGRLLVGAEDHLFSFDLVNINRDQKQIAWPAT
PSKRDECKWAGKDFWKECNNFIRVLQPYNQTHLYICGTGAFHPICAFLEMGKRAEDNVFR
LASHFENGRGKSPYDPKMLSASLLIDGELYSGTSADFMGRDFAIFRTLGDHHPIRTEQHD
SRWLNEPRFVGVHLIPESDNPEDDKIFLFFKENAMDGEHTGKATISRIGQLCKNDMGGHR
SLVNKWTTFLKARLLCSVPGINGIDTHFDELQDVFLMSSKDPKNPVIYAVFTTSSNIFKG
SAVCMYNMADIRRVFLGPYAHRDGPNYQWVPFQGRVPYPRPGTCPSKTFGGFDSTKDLPD
DVITFARGHPAMYNPVHPIGGRPIMVRTDVDYQFSQLVVDRVEAEDGQYDVMFIGTDVGT
VLKVVMIPKESWHDLEEVVLEEMTVFREPTPITAMELSTKQQQLYLGSALGVSQMPLHRC
EVYGKACAECCLARDPYCAWDGTECSRYFPTAKRRTRRQDIRNGDPLSQCSDLQHHEESD
GVGSVEDRSVYGVENSSMFLECSSKSQRALIYWQLQKPDDDRRLEIKFDDRILRTDQGLL
IRSLAQSDVGVYHCQAVEHGFIQPLLRLSLQVIPAQKVGELLPGPPAADGGVDQSAKHRL
WYRDFLSLLDHPDLSSVEEFCDRVWKKERKQKRVKTPNGNAQGRTDGGSNSALQPKASNP
QKQQAGPPQSRPWLQAGAPVAEKSQKGTQNVGAVGSQAPKNSQKTQKGNAAASLVVGGSR
ANSQHTAKWRRMQENKKGRNRRTHELQRPPRSV
Download sequence
Identical sequences H3D0C1
99883.ENSTNIP00000013957 ENSTNIP00000003045 ENSTNIP00000013957

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]