SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013964 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013964
Domain Number 1 Region: 131-329
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.33e-47
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.011
Further Details:      
 
Domain Number 2 Region: 14-103
Classification Level Classification E-value
Superfamily WWE domain 1.06e-18
Family WWE domain 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013964   Gene: ENSTNIG00000011031   Transcript: ENSTNIT00000014159
Sequence length 330
Comment pep:known_by_projection chromosome:TETRAODON8:19:2809947:2812364:-1 gene:ENSTNIG00000011031 transcript:ENSTNIT00000014159 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYYRKQITSSEEESPENEEMDTSESNWCWFYLAECGVWHMFEIDPSASCSVTSAQIEQCY
SRNQRGVMEFYTAKYTYRLDFSMMRQINVTTGKQRPIKRSLHSATGFRFICDNLALPVPC
HWERINTDEPYQLIQLGRDTHEFKEVARLYERTMDHPIKSIQRIQNLDLWEFFCRKKTQL
QKVKRTLDIEERMLFHGTGYSNIQAICTFNFDWRLTGSHGGVYGKGSYFARDAKYSSKFC
HTTGKHNVTLQKHGLAPPIFASEPPYKTMFLARVLVGEYSVGHHMYCRPPSKDTSFTSFY
DSCVDDMANPKIYVIFDSNQIYPEYMIEFY
Download sequence
Identical sequences H3D0C8
99883.ENSTNIP00000013964 ENSTNIP00000013964 ENSTNIP00000013964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]