SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013972 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013972
Domain Number 1 Region: 14-242
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-72
Family BAR domain 0.0000000207
Further Details:      
 
Domain Number 2 Region: 277-345
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-22
Family SH3-domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013972   Gene: ENSTNIG00000011037   Transcript: ENSTNIT00000014167
Sequence length 350
Comment pep:known_by_projection chromosome:TETRAODON8:18:7319611:7332147:1 gene:ENSTNIG00000011037 transcript:ENSTNIT00000014167 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKATQQKVSEKVGGAEGTKLDDDFTEMEKRVDVTSRAVLDIMTKTTEYLQ
PNPATRAKMSMMNSMSRMRGQEKGPGYTQTEAILGESMQKFGRELGEESSFGLALVDIGE
AMRDGEVKDALDMEVKQNFIDPLQNLHEKDLKEIQHHLKKLEGRRLDFDYKKKRQAKVTE
DELKQALEKFDDSKEIAEQSMFNLLESDIEQVSQLAALVQAQLEYHSRSAEILTQLSSKI
DERIREASGKPRKEFVPKPRTSLDFSISENHNGGIHGARSPARSPAPMDQPCCRALYDFD
PENDGELGFKEGDIITLTNKIDDNWFEGMLHGNSGFFPINYVDTLVPLPH
Download sequence
Identical sequences H3D0D6
ENSTNIP00000013972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]