SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013984 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013984
Domain Number 1 Region: 683-1038
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 1.44e-110
Family Hect, E3 ligase catalytic domain 0.000000231
Further Details:      
 
Domain Number 2 Region: 2-382
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.14e-98
Family Regulator of chromosome condensation RCC1 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013984   Gene: ENSTNIG00000011048   Transcript: ENSTNIT00000014179
Sequence length 1046
Comment pep:known_by_projection chromosome:TETRAODON8:18:7427057:7434952:1 gene:ENSTNIG00000011048 transcript:ENSTNIT00000014179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCWGKAKDGQLGIEVERNSMFEPRNCNVFSGRGLKEAVCGGQHSVFLLHDGSVYTCGSN
GCGQLGHNKPGTSPELVGALDTQRITLVSCGQAHSMAVNEQGQVFAWGAGDGGQLGLGTT
EAAVRIPSFPRLIKRLCDHRIAQVMCGNQHCIALSKDGQLFTWGQNTSGQLGLGKGEPSK
LFPQPLKSLAGIPLAKITAGGDHSFALSLSGAVFGWGKNKAGQLGLNDIQDRAVPCHIKF
LRSQKVVHISCGDEHTAALTKDGGLFTFGDGSWGQLGHGSTSNELLPRRVLELMGTEVSQ
ITCGRHHTLAFAPSSGVVYAFGGNSHGQLGTGELSAEKCLYPVKINLLSDFSCHCFNSLD
SKKYSVTKITCGGDHSFLLYSNEQSLEYPEDFRVINIGNSISPINYERLNSWRLKMMCNK
DSTVTNDINIQLSSTACWNASFLDQSDDAHFSTNPKIPGIDLNSVRMFFATLSTPAFSAL
LEQATKSFESVLIPQLPRSPPDVEAMRIYLILSEYPALQDTKNYIRLTIPLAMAILRLDA
NPSKVLDNWWCFVDDGVFTRMVDIYKSIVVFLLRGGKTLLLPISYENYFVATLRLLEKLH
KVNLKAHHVEYNHFYIPDITSMVDIQEDYLKWFLSKAQITDFPSVNLCAYPFLLNAQAKT
TMLQTDAELQMQMAVSGANLHNVFMLLTLEPQLARNPYLVLHVRRNHLVSDVRELTSYSD
VDLKKPLKVIFDGEEAVDAGGVTKEFFLLLLKELMDPIYGMFTFHNESNLLWFSDKCFVE
QKWFHLIGIICGLAIYNSTVVDLHFPLALYKKLLDVSPTLEDLKELSPTEARSLQQLLDY
ENEDVEETFLLSFAITRENYGIIEVKELVPGGESISVDKNNRKEFVEAYLRYIFSDSASE
QYSAFSAGFLKVCGGEILSLFQPCELMAMVVGNSNYNWEVMEKNTVYKGEFTATHPTVRL
FWEVFHEFPLEKKKQFLLFLTGSDRIPIHGMESLRIVIQSTMAEERYLPVAHTCYNLLDM
PRYQTKEILRCRLTQAVEQYEGFSLV
Download sequence
Identical sequences H3D0E8
ENSTNIP00000013984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]