SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014019 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014019
Domain Number 1 Region: 43-259
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.86e-63
Family SPRY domain 0.0000000228
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014019
Domain Number - Region: 248-285
Classification Level Classification E-value
Superfamily SOCS box-like 0.000173
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014019   Gene: ENSTNIG00000011084   Transcript: ENSTNIT00000014215
Sequence length 286
Comment pep:known_by_projection chromosome:TETRAODON8:15:4199343:4213652:1 gene:ENSTNIG00000011084 transcript:ENSTNIT00000014215 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQKISSGIKSVDGRGDSGSSPSYRPLAHRRQHPQLRDPDFSKPARLDLLLDMPCAGLET
QLRHAWNPDDRSLNIFIKEEDKLTFHRHPVAQSTDCIRGRVGYTRGLHVWKIHWPARQRG
THAVVGVATSEAPLHSVGYTALVGSDCESWGWDLGRHRLYHDSKNRAHSSLSSYPSFLEP
EDSFTLPDSLLVILDMDEGTLSFMVDGQYLGVAFRGLKGKKLYPVVSAVWGHCEISMKYI
NGLDPEPLPLMDLCRRAARLALGRDRLQEIESLPLPQSLKNYLQYQ
Download sequence
Identical sequences H3D0I3
ENSTNIP00000014019 ENSTNIP00000014019 99883.ENSTNIP00000014019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]