SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014036 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014036
Domain Number 1 Region: 184-360
Classification Level Classification E-value
Superfamily vWA-like 4.61e-47
Family Integrin A (or I) domain 0.00029
Further Details:      
 
Domain Number 2 Region: 3-149
Classification Level Classification E-value
Superfamily vWA-like 6.52e-33
Family Integrin A (or I) domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014036   Gene: ENSTNIG00000011101   Transcript: ENSTNIT00000014232
Sequence length 429
Comment pep:novel chromosome:TETRAODON8:Un_random:92066989:92068719:-1 gene:ENSTNIG00000011101 transcript:ENSTNIT00000014232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKDLETHDDAVRMAVMQYSDDVMVHFNLKSHNSKKALINALRNLRHKGGRNRKTGAALQ
FVRDRVFTTLFGSRHLEGVPQILFLLTLGKAGDDVSKAALSLKQFGVQTFAIGIKKAKLQ
ELQQIASPSRFLYNLPVFGELLSIQPQLAALVQQRTEYPVARMLKTFAFLTSPSFNFELE
NQQSDIVFLMDGSEDTRSDFPAMKALVERTVDALNIGDDKVRVSVVQYSRDPQTHFNLNS
YSTKQDVLAAVQQLNHKGGRPLNTGAALNYVRNSAFADSSGSRKQDGVPQILIFLTGGRS
QDNVMSVAAALKQDGVVPFCVGTRNADILEQQMIAFDPSYTFTGLGVDDTGSIAQRLLTF
VKRVPRQPRLTSEKTLGETRSFAFSRFLLLSLALSLPLSLSASIILNFIPVSADQTQSSQ
HDIVFLLDS
Download sequence
Identical sequences H3D0K0
99883.ENSTNIP00000014036 ENSTNIP00000014036 ENSTNIP00000014036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]