SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014053 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014053
Domain Number 1 Region: 232-425
Classification Level Classification E-value
Superfamily vWA-like 2.36e-32
Family Integrin A (or I) domain 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014053
Domain Number - Region: 502-535
Classification Level Classification E-value
Superfamily YueI-like 0.0119
Family YueI-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014053   Gene: ENSTNIG00000011118   Transcript: ENSTNIT00000014249
Sequence length 847
Comment pep:novel chromosome:TETRAODON8:11:1957465:1962248:-1 gene:ENSTNIG00000011118 transcript:ENSTNIT00000014249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEVYSVMVDCTVASRFARTVMTSKAWNKANARQISFEVQLPKTAFISNFSMEINGRVYV
GEVKEKEKAKQQYEKATSAGKTAGLVKAAGRKMEKFSVSVNIAANSTVAFVLTYEELLQR
KMGQYEILTQVTPELPVQEFQIVADIYEAQGLAFVEASATFLTNELLPLVKKTVTDTRAH
VSFSPTLEQQRKCPGCEGTIINGDFIIKYGVKQEQSLGEVQIVNGYFVHFFAPPHLPRVP
KNVVFVIDRSGSMNGMKMQQTRDALQAILKDLHEEDHFALVVFDSTVSQWRNSLTKATKK
NVSQAINYVKTIKDRGATALHEALMTGKMLRKEREEAKLPERSADMIITLTDGMPNHGVS
DIKVIQKDVQSAIGGNMSLFCLGFGNDVDYSFLDVMSRQNKGLARRIFTGSDATLQLQGF
YDEVSSPLLLDVDLRYPENTVDLLTKTQYSQLFNGSEIVVSGQLTNNDPENFLVEVFAKG
AEHDFQVRGKARVLDTDVIYPEKDYIFGDFSERLWAYLTIQQLLENRFPTQFVNRHHSEK
DRNSAKALEMSLRYGFVTPLTSMVVTKPESDRSSPLLADKLTERAEQADINYSVNYSQKV
QRPRGPPFLVDGDPHFMIEPDRGDSLCFNINGNPGTIFNLVTDAKSGFIVNGEIVGKKKD
APGGNSNNYIGRLGISHKKLGVRLDVSTQDISVFHDGKHIKLLWSDTASVKSTNLDLRLV
KNCSLTVTLKHAVKFEVIKHSKVWKRQHKHQEYLGFYTLDSHHLSASVHGLLGQFYRGIE
FEVTESLQSPDAIMYVKGQTLNVTRHWQKDFSQQVIDGKVMPCWFVNNNGTGLIDGKPLD
YIVSGLF
Download sequence
Identical sequences H3D0L7
99883.ENSTNIP00000014053 ENSTNIP00000014053 ENSTNIP00000014053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]