SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014054 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014054
Domain Number 1 Region: 203-439
Classification Level Classification E-value
Superfamily vWA-like 1.7e-33
Family Integrin A (or I) domain 0.019
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014054
Domain Number - Region: 726-817
Classification Level Classification E-value
Superfamily Translation proteins 0.0895
Family Ribosomal protein L3 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014054   Gene: ENSTNIG00000011119   Transcript: ENSTNIT00000014250
Sequence length 863
Comment pep:novel chromosome:TETRAODON8:11:1965334:1975057:1 gene:ENSTNIG00000011119 transcript:ENSTNIT00000014250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARSLQKRSTDGGTVEVHSFTVDCTVRSRFARTLMTSTALNKGNTSREISFEVELPKTAF
ISNFSMEIEGQVYVGEVKEKEKAKKQYEKAVSAGRTAGLVKASGRKMEKFSVSVNIASNS
KVTFVLTYEELLQRTLGQYEILTRVKPKEPVQEFKIVTNIYEPQGLSYVDAQATFLTNDL
LPLVEKTVTDKKARISFSPTIEQQRKCPDCPGTLIDGDFIIKYDVNRENDLGDIQIANGY
FVHFFAPKDLPRLPKNVVFVIDMSGSMSGTKMQQTREAMLKILEDLDPEDHFGIILFDHR
IQFWNTSLSKATKENIDEAMVYVKAIQSYGGTDINAPVLKAVDMLKEDRKAKRLPEKSID
MIILLTDGDPNSGESRIPVIQENVKAAIGGQMSLFSLGFGNDVKYPFLDVMSRENNGLAR
RIYEGSDAALQLQGFYDEVSSPLLLDVDLRYPDNAVDSLTTNQFSQLFNGSEIVVAGRLK
DNDIDNFPVEVSGQGLNDFSEQGQFSVLDWSGMYPDDDYIFGDFTERLWAYLTIQQLLDK
SKTGDAEEKANASAEALDMSLRYSFVTPLTSMVVTKPETDDSPMIADKLTEEQRQQAERA
GNYNYGYSAPPAPPTYFVDGDPHFMIELPDRNDALCFNINDKPGTIFNLVRDPVSGILVN
GQIIGDKKIPPDGVINTYFYRFGITHRTLGVKLEVNTEVISVYQGGKWIKLLWSEASSLK
GPNVDILLTKDRSLTVTLKDSVKFVVLLHKVWEKHPYHRDYLGFYTLDSHLLSSSAHGLL
GQFYHGLEYEVSDLRPGEVPEKPDATMFVKGQQLNVTRGWQRDFRNDVKNGENVPCWFVH
NNGTGIIDGDASDYIVSGLFKTT
Download sequence
Identical sequences H3D0L8
99883.ENSTNIP00000014054 ENSTNIP00000014054 ENSTNIP00000014054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]