SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014119 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014119
Domain Number 1 Region: 38-318
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.91e-64
Family BAR domain 0.00068
Further Details:      
 
Domain Number 2 Region: 430-538
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.22e-42
Family Pyk2-associated protein beta ARF-GAP domain 0.00013
Further Details:      
 
Domain Number 3 Region: 271-389
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-24
Family Pleckstrin-homology domain (PH domain) 0.0043
Further Details:      
 
Domain Number 4 Region: 575-695
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-23
Family Ankyrin repeat 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014119   Gene: ENSTNIG00000011184   Transcript: ENSTNIT00000014315
Sequence length 754
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92192132:92197430:-1 gene:ENSTNIG00000011184 transcript:ENSTNIT00000014315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EEPSGRRPCTRPCTRPAAPPDACAAAAGTGGWNMDSLLDFEECVRDSPDFRRKLQQFEAE
VSELETHLENVMKLCGRMVEAGQAYSAANQLFLSGLSQLSVFQEKPSIITACLNQFSQGL
QEMVGFHTMLFDQMQRAINHQLSNLCTRFLPQLAETRRDFVRIGDDLETAAAKSAQASRH
RGGEAERMSHLLLATRKFQHFALDYCLQINSFKTQQRLDTLNSVFSFVHAQVTFFHQGSD
LIRDLEPTMKTMAAQLSQLSADCSARRKELENTHLLVQQRDASGEPSVRPLPGSSDVLHG
HLFKRSRRKSKTWKRCWFSIRDNQLLYRKTHEDEDVVLFQDLRLCAVRPLENLERRFCFQ
LLSVQKCCVLQADSEQLKQSWLGALQGSIHLAYRDGGERHLAQVSEVPPVPGGADSAQGA
GPVALGVALRGSGNQVCCDCGEEEPRWASVNLGITLCIECSGVHRSLGVHLSKVRSLTLD
SWEPEQLKLLCILGNDVINQIYEARCPEEGRDKPRADSQRAAKESWIRQKYVDKSFVRSG
GSAGGSAPPPPPLSSCSSSTPPSAPGEDQDVTLGLYRAALAGDLVAMAAALAQGAEVNGS
LSGEQGRTALIGAAVGGSLLACEFLLLNGAKVNHRDLRGQGALHAAATAGHTGQVCLLLR
RGANQYAADETGQDPLAIAVETAHADIVTLLRMARMNEEMRDSEGAFGPAGDDETFQDIF
RDFSDMASHDPEKLSRRHFNRSGDEDETKENPLQ
Download sequence
Identical sequences H3D0T3
99883.ENSTNIP00000014119 ENSTNIP00000014119 ENSTNIP00000014119

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]