SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014120 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014120
Domain Number 1 Region: 332-402
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.32e-17
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 2 Region: 244-308
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.000000719
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 3 Region: 298-334
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000789
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 85-119
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000115
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014120   Gene: ENSTNIG00000011185   Transcript: ENSTNIT00000014316
Sequence length 688
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92208076:92214440:1 gene:ENSTNIG00000011185 transcript:ENSTNIT00000014316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPVRSFLSALSILCVRLLSADGQTGGADRIQVMFTPTICQVRCSQGRCLNSCERGNLTT
LYSAGEAAAGRRDGAQSPSFRVFVCPLLCQNGGVCLQTDRCLCPPTFTGKFCHIPVTMTP
ATPPSTNDIASHSEFLMPLGSHPEGASAGAPSPSMVKVRVQHPPEASVKIHQVLKQRSEF
KYCFREVKDGQVRTRDTFRVQTRSLHPPEGAGLLTPLERSRCGWKLVWFHRDGASVLGDG
PGCSPLPGLRSKDMCCRGIGKAWGITSCVLCPQNTGKSTGQNNNSCPAGFQRTNQTHWLC
DNGLCVNTRGSYSCVCRAGFILDASHGICAVISEEKGQCFRVLGSGLGPASCSLPILRNI
TKQICCCSRVGKAWGAACLRCPYFGSAAFKELCPAGPGYQYSASAQQFNQRVSEQLGAPR
RPAELGHPKPGPQTPPASPQGNRPPCCWFSWTFWVLKQVVFCREPVPARSGPWPSHRSCV
SGSCDRFRRLCGVRCCVGRTSSPKTRRCLKLFLLYPRNLDWARSRPQSEVRQVLSVSRVN
GWKCGPAGYHGYRRQGYPLTFATCFCREEETLVRDVVGGRSAGPPPLPHRWVHTLPEDLE
QDQDQHLDLLLALDLEQRAPAVERLPGPDVMDVMVGFLLTDVQAVLHLIQMWDQNQTSWT
FTLSVWILVLLQLHASVTISLALRICRQ
Download sequence
Identical sequences H3D0T4
99883.ENSTNIP00000014120 ENSTNIP00000014120 ENSTNIP00000014120

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]