SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014121 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014121
Domain Number 1 Region: 327-396
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.62e-17
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 2 Region: 207-275
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000051
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 3 Region: 275-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000001
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 56-91
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000408
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014121   Gene: ENSTNIG00000011186   Transcript: ENSTNIT00000014317
Sequence length 397
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92215299:92218880:1 gene:ENSTNIG00000011186 transcript:ENSTNIT00000014317 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIQVMFTPTICQVRCSQGRCLNSCERGNLTTLYSAGEAATGRRDGAQSPSFRVFVCPLLC
QNGGVCLQTDRCLCPPTFTGKFCHIPVTMTPATPPSTNDIASHSEFLMPLGSHPGGASAG
APSPSMVKVRVQHPPEASVKIHQVLKVGPRLPASCLQASSHWSLCPWPQISGPGPAPALQ
ALVASTSSGSAGAPAPAALAGGPPQQRSEFKYCFREVKDGQCSSPLPGLRSKDMCCRGIG
KAWGITSCVLCPQNTGKSTGQNNNSCPAGFQRTNQTHCAVDVNECLLPGLCDNGLCVNTR
GSYSCVCRAGFILDASHGICVCAQAVISEEKGQCFRVLGSGLGPASCSLPILRNITKQIC
CCSRVGKAWGAACLRCPYFGSAAFKELCPAGPGYQYS
Download sequence
Identical sequences H3D0T5
ENSTNIP00000014121 ENSTNIP00000014121 99883.ENSTNIP00000014121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]