SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014129 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014129
Domain Number 1 Region: 205-333,628-801
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 5.89e-52
Family Diacylglycerol kinase-like 0.023
Further Details:      
 
Domain Number 2 Region: 1013-1079
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.43e-18
Family SAM (sterile alpha motif) domain 0.0029
Further Details:      
 
Domain Number 3 Region: 106-174
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.79e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000392
Further Details:      
 
Domain Number 4 Region: 42-100
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0094
Further Details:      
 
Domain Number 5 Region: 1-59
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000532
Family Pleckstrin-homology domain (PH domain) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014129   Gene: ENSTNIG00000011194   Transcript: ENSTNIT00000014325
Sequence length 1086
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92274663:92287540:1 gene:ENSTNIG00000011194 transcript:ENSTNIT00000014325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VITPCRRLILCADNRKEMEEWMAALRSVQNRQNYESTQYSMDHFSGMHNWYACSHARPTY
CNVCREALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDEDGVSMPH
QWLEGNLPVSAKCHVCDKTCGSVLRLQDWRCLWCKAMVHSGCKDLLSSKCPLGQCKVSVI
PPTALNSIDSDAGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLM
NGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDALTLHKQCQLGVLPLGTGNDLARV
LGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKFPRQHSVSTVTEDCSEDSEVQ
QILTYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKNTESSEESEAM
AKKCGVLKEKLDSLLKTLNEESQASSVPHLAPPPTIAEEQEETEGNTTGGVSGSCSSRSG
ASPAAAAIFKPREQLMLRANSLKKAIRQIIEHTEKAAVDEQNAQTQQQLFSLSRDEEEEV
VLQRQAPQHSQEWGLLRAEGPGTVGKTPCEKLMGKGSREGTPLLSTKILYPGLRVLSGSL
SSSSVISRLLVNADPFSCDPDNMDCYTEKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCR
SRTKNMMWYGVLGTKELLHRTYKNLEQRVLLECDGRPIHLPSLQGIAVLNIPSYAGGTNF
WGGTKEDDTFTAPSFDDKILEVVAVFGSMQMVVSRVINLQHHRIAQCRTVKITILGDEGV
PVQVDGEAWVQPPGYIKIIHKNRTQTLTRDRAFESTLKSWEDKQRCEFPRASPAQPPLSS
QPEIVSEEEASLISEFGQAAGALIHSIREVAQCHHSLEQELAHAVNASSKAMDLVYANSK
GSGTLGCGLVLQMVVNVKVLLRETELLLAGKMSMQLDPPQQEQLNAALGSVALQLRGMAD
VSWLCPVIEPLDQEGPLTDFSKRSRSAKFCLVPKFKKDKNNKNKETCATLSLPVHQWGTE
EVGAWLDFLCLTEYKDIFTGHDVRGAELLHLERRDLKDLGVTKVGHMKRILQGIRELNRS
SSASEA
Download sequence
Identical sequences H3D0U3
ENSTNIP00000014129 99883.ENSTNIP00000014129 ENSTNIP00000014129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]