SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014130 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014130
Domain Number 1 Region: 88-216,504-576
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 3.49e-34
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 1-57
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000778
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000977
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014130   Gene: ENSTNIG00000011195   Transcript: ENSTNIT00000014326
Sequence length 581
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92265639:92269147:1 gene:ENSTNIG00000011195 transcript:ENSTNIT00000014326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHQWLEGNLPVSAKCHVCDKTCGSVLRLQDWRCLWCKAMVHSGCKDLLSSKCPLGQCKV
SVIPPTALNSIDSDAGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVF
DLMNGGPHLGLRLFQKFDTFRILVCGGDGSVGWVLSEIDALTLHKQCQLGVLPLGTGNDL
ARVLGWGSACDDDTQLPQILEKLERASTKMLDRWSIMVYETKFPRQHSVSTVTEDCSEDS
EVQQILTYEDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKNTESSEES
EAMAKKCGVLKEKLDSLLKTLNEESQASSVPHLAPPPTIAEEQEETEGNTHSCSSRSGAS
PAAAAIFKPREQLMLRANSLKKAIRQIIEHTEKAAVDEQNAQTQQQLFSLSRVSAVVLQR
QAPQHSQSCSSSAVLSAWTVGKTPCEKLMGKGSREGTPLLSTKILYPGLRVLSGSLSSSS
VISRLLVNADPFSCDPDNMDCDSEKCVMNNYFGIGLDAKISLDFNNKRDEHPEKCRSRTK
NMMWYGVLGTKELLHRTYKNLEQRVLLECDGRPIHLPSLQG
Download sequence
Identical sequences H3D0U4
99883.ENSTNIP00000014130 ENSTNIP00000014130 ENSTNIP00000014130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]