SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014132 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014132
Domain Number 1 Region: 421-713
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.06e-74
Family Eukaryotic proteases 0.00013
Further Details:      
 
Domain Number 2 Region: 185-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-30
Family Spermadhesin, CUB domain 0.000031
Further Details:      
 
Domain Number 3 Region: 25-136
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-29
Family Spermadhesin, CUB domain 0.0000329
Further Details:      
 
Domain Number 4 Region: 299-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000162
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 365-432
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000403
Family Complement control module/SCR domain 0.00096
Further Details:      
 
Domain Number 6 Region: 132-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000027
Family EGF-type module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014132   Gene: ENSTNIG00000011197   Transcript: ENSTNIT00000014328
Sequence length 718
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92291385:92295207:-1 gene:ENSTNIG00000011197 transcript:ENSTNIT00000014328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSRNWLLFSAFHPPSAWLFPPSSLENGSLQSPNFPDPYPRETRLRWNLSVPAGFRLRLYF
SHFHLEPSYLCEYDSVKVEAEGEVLALFCGKEDTDTESVPGQQVIGSPGNALSLLFTSDF
SDEERYSGFQAHYSAVDVDECSERADEDLSCDHHCHNYLGGFYCSCRYGYLLHSDKRTCR
VECSDGVFTERSGVLSSVDFPSPYPKSSECVYRIQVEPGLRLRLQFDARFDVEDHPDVSC
PYDHVMIKAGTRTFGPFCGNRSPGEIQTDTNAATVSFHSDNSGENLGWKITYTSTEVRCE
VLQAPPHALLQPVQSEYSVGDQVVYSCEPGHRLLKDGRVLSRYQLHCQADGSWSDGPPRC
HAADCGSPALVPGADVVFGSHDNSTLLGSTLSYVCREDGSNSSYRCGPSGSWVSPELGTG
LPSCLPACGRPSRPLPALMKRIVGGRSAEPGLFPWQVLLSVEDLSRVPKDRWFGSGALLS
ESWVLTAAHVLRSQRRDASVVPVAPQDVKVFLGLHDAGDKRWATNRSVERIVLHPNFQAD
SYDSDIALLRLSQGAELSELIQPVCLPRLRPQDAWRWPLPNSLGVVAGWGISSPNGSSPG
SPSSLSSDPGLTSDLLQYVKLPVVSQDECESSYASRSARYNITANMFCAGFLEGGRDTCL
GDSGGAFVMEDGASRWAVFGLVSWGGPGACGSQGLYGVYTRVAAYVEWILEQVHTGPR
Download sequence
Identical sequences H3D0U6
ENSTNIP00000014132 99883.ENSTNIP00000014132 ENSTNIP00000014132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]