SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014168 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014168
Domain Number 1 Region: 1428-1536
Classification Level Classification E-value
Superfamily C-type lectin-like 5.42e-40
Family Noncollagenous (NC1) domain of collagen IV 0.0000169
Further Details:      
 
Domain Number 2 Region: 1576-1656
Classification Level Classification E-value
Superfamily C-type lectin-like 3.06e-25
Family Noncollagenous (NC1) domain of collagen IV 0.000072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014168   Gene: ENSTNIG00000011231   Transcript: ENSTNIT00000014365
Sequence length 1658
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:92487432:92527820:1 gene:ENSTNIG00000011231 transcript:ENSTNIT00000014365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFPGMPGSPSGPGFPAGPFGPCGPSGPGRPGCDDPGGPRGPGGPFSPGSPGGPSAPALPG
KPGNPGRPLGPWGPSTPTKRERGKPMNPGGPGGPGSPGSPGLPQAPRSPGRPLTPGLPLI
PGYPGLPLKPSGPSSPMSPTNPGGPTGPAFAPCEPDIPRKPERPASPIKPAKRRLNSESH
RWTQGLTGTQGKVSPIGREIGKGLPLDPFGPDGPGSPGGPGSPGSPRLPTAPTTAGPGLP
DGPGNPFGPGSPGGPLSPVELVNPGLPGCPCGPLFPFSPTTKKEPYRKVTLGTWPLTLIT
EPTEGVSAGKEHTCSPVLPVSPGDPVSPFGPGAPGAPEVPITPRSPSGPGRPLITGQRWD
DPKPGMWSPGFPGFPGSPSVGPSLNNWPGAPFWPFNPVAPICPTTPAGPGRTPADNGFMN
YDSVKGRQNKRKFLCHCNGVKGRKGEPGFPGYGGLPGVIGYPGNEGQQGPPGEKGLPGRP
GLPGPSGLPGLPGHEGSIGQTGFPGCNGTKGEVGFPGFPGSPGRVGLQGKPGPGGAKGLR
GDPGEPGLPGLQGFAGLPGMPGLPGLLGNKGQEGPSPVIPGPQGQKGDRGPPGVPGQKGI
KGEPGDVGEKGCRGHSGVPGKLGPKGDKGIHGDPGPLGKPGKDGIPGELGEQGEPGIQGF
LGPPGIEGTEGGKGDRGFPGLPGENLLSNGSGLIGFPGLQGEPGLAVPGLSGPPGPPGFA
GPKGEPGTPGLMTTGPPGQNGVPGIPGGEGDQGEPGIPGKVLRPRGLIGQIGPLGPLGIG
DPGPQGLKGLEGVPGQQGDPGNSEFGLCHPLGEKGSPVRCFGVPGEPGPVGPKGKKVHGL
PGFEGGDQGFGFPGQQGQLGLTGEDGSVGPQGELGHQGPEGMLGSQGQIGPPGEKGDTLK
GEKGLPGVRGAIGFTGLCLPGATGRKGDEGPLGVIGFTGPRGLKGVQGDRGPPGTGSPGS
QGPHGVPGVDGPLGPGGQIGLKGFRGTTGDTGRKGLKGAEGSPGVFGRPGTDGNPGETGQ
PGAKGQMGKHGVQGAQGSQGPQGDRGVPGVKGIQTVVETYGSPGDSGQPGTVFCSVLKYL
PGLSGAPAKSPPTMLNIPFDSPLGPTGTTGCEGERGPPGSEGQDGNNGATGDAGPAGPPG
DPGRNGAKGPPGPSGIMGSIGEMGRPGLKGEKGLIGPCGKKGLDGKPGIEGFKGSKGDPS
PVGIGPKGFPGDKGNPGSPGPQGYKRPPGSRGPPGPPGPGFKGEKGGRGTTGTPGQPGCP
GEPGPTGTKVRPGFKGEKGGRGTTGTPGQPGCPGEPGPTGTKGNNGAPGPAGQKGNLGEM
GCTGPAGKSCGINGDRGSPGTPGFEGSPGLPGRRGDQGLPGEQGAPGQRGSPGPSGRPGF
PGGSQGPKGENGAPGVQGSKGSAGLQGPTGAKGVPGPPGACTDAPQQDSFLFTRHSQELY
IPECPAGSTQVYSGYSLLFINGNNRAHGQDLGTLGSCLPRFTTMPFLFCNTDRTCRYASR
NDYSYWLSTNKMVLSNMPLISGDLLRSYISRCSVCESQTCPLLCPLVRTFKLLETRRCPI
KVDAARLRRFIETRETGVGAEGSGQPLASPGSCLEQFRKIPFIECHGRGTCNYYTDSYSY
WLAALNPDDMFSKPKPQTETGDFPGSLISRCRVCMKKV
Download sequence
Identical sequences H3D0Y2
ENSTNIP00000014168 99883.ENSTNIP00000014168 ENSTNIP00000014168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]