SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014180 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014180
Domain Number 1 Region: 185-306
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-37
Family Third domain of FERM 0.00054
Further Details:      
 
Domain Number 2 Region: 84-184
Classification Level Classification E-value
Superfamily Second domain of FERM 3.4e-29
Family Second domain of FERM 0.0001
Further Details:      
 
Domain Number 3 Region: 4-84
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-23
Family First domain of FERM 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014180   Gene: ENSTNIG00000011241   Transcript: ENSTNIT00000014377
Sequence length 309
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:17780767:17783705:-1 gene:ENSTNIG00000011241 transcript:ENSTNIT00000014377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLRLRVIFLDDSERSFEVEQKVLGGDFFNKVCGHLKLLEKEYFGLEFRHHSGNYVWLELL
KPLAKQIKYTNNLFFRFIVKFFPPDPGQLRRGLTRYLFALQIKQDLSNGSLTCHDNSAAL
LVSHILQSEVGDYDEELDCHHLEMKQYVPNQEYLDHKIVKFHKKHRGMSPAQADIQLLEV
ARRLDMYGIRPHPAHDGEGMRINLAVTHSGVLVFQGNTKINTFSWAKIRKLSFKRKYFLI
KLHDQIGPSCKDTLEFSMASRDVCKSFWKNCVEYHAFFRLPEEPRSIQKALLFSKGSSFR
YRYGRKHFF
Download sequence
Identical sequences H3D0Z4
ENSTNIP00000014180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]