SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014247 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014247
Domain Number 1 Region: 10-49
Classification Level Classification E-value
Superfamily UBA-like 0.000000168
Family TAP-C domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014247   Gene: ENSTNIG00000011307   Transcript: ENSTNIT00000014445
Sequence length 166
Comment pep:known_by_projection chromosome:TETRAODON8:3:14433021:14438714:1 gene:ENSTNIG00000011307 transcript:ENSTNIT00000014445 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVNMDELRHQVMINQFVLTAGCAADQAKQLLQAAHWQFETALSSFFQETNIPGHQHQMT
CTPRNTPATPPNFPDAITMFSKLRASECSSSSAAGPSQVSMACSPPAPSSTPGFGSFWAA
SPPNHQPAWLPPSSPTGHHKTPMWPPVSQSGSSQQPHVVSALQGQR
Download sequence
Identical sequences H3D161
ENSTNIP00000014247 ENSTNIP00000014247 99883.ENSTNIP00000014247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]