SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014295 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014295
Domain Number 1 Region: 434-609
Classification Level Classification E-value
Superfamily p53-like transcription factors 5.28e-72
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000116
Further Details:      
 
Domain Number 2 Region: 611-710
Classification Level Classification E-value
Superfamily E set domains 7.94e-29
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014295   Gene: ENSTNIG00000011351   Transcript: ENSTNIT00000014493
Sequence length 1069
Comment pep:known_by_projection chromosome:TETRAODON8:5:2621124:2651452:1 gene:ENSTNIG00000011351 transcript:ENSTNIT00000014493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTANCPGNEELDFRLIFGEDGQQQPLGPADLEPDDNTSFYILNVGQPQSVVTNHQPLGL
PRHGMQSHSQIISTSPRFQTHRPGSEPPGYETQDSKYGTSPLLSSAPLEAPKAFACPSIQ
ITSISPSCQQEMDPNENALSANGPDRDFHGDRPLSRDHLYLPLDHAYRDSSLSPSPCSSL
SSRSWFSDASSCESFSHIYDDVDSELNEAAARFTLGSPLTSPGCASPQASGGVLEEQPHW
QHHHPTIVHQSHTINLSPRQSPCHSPRTSVTDENWLSPRPPSRPSSRPTSPCGKRRHSSA
DLCYAGSLSPHHSPTATPGPSPRSSVTEDTWVGSPTVGMSPFSCCPSEADIPLKTRKTSQ
DRTTMQTVKGELGLDEQGNMSPNLDSPSDEAMHSLKKDGPGEQFLSVPSHFSWNKPKPGH
TPIFRTSSLPPLDWPLPSQFGQFELKIEVQPKAHHRAHYETEGSRGAVKASSGGHPIVKL
IGYNEKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEILVSCTKVLEIPLLPE
NNMSASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVLSLQAASIP
VECSQRSAQELPQVDKSSLTSCLVSGGEEMVISGSNFFPESKVIFLEKGPDGRPQWEVEA
KIIREKSQGSCIVVEVPPYHSKTVASAVQVQFYVCNGKRKRSQSQRFTYLSVTVRQEHRD
ELDLPPVPPISMPLAHASSLVCTQLPSPEQGHPSDTFCSGPGLLPLQPPCPPLGSPSFQH
LPHLQGHSLQHHPADCHMPFHPNSVPAPARPSYQPMQHSHSHNLPFNGQPSLPSQGYERM
PFQHSPSSGPHPMAMGMVYSSSPCSSPSAPSTPGSNPIVGSPQSQQNLLNPSSPHLHALG
GYHCSPNPTPVPSPPGHPLVVQHSSQLQRAMGYHPIGQRSASCPTPSSAPPPPPPPRMVP
SPHSGPSSPQLHSLPYQSPTSSSPTPGQQQHSGQPSPQATSPVMAGLSPATAAGPLVHPL
SPQGPFPTDGERLNIKQEPEEREPTFRSIGLQDITLDDVNEIIGRDMSQ
Download sequence
Identical sequences H3D1A9
ENSTNIP00000014295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]