SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014298 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014298
Domain Number 1 Region: 493-660
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.7e-70
Family A middle domain of Talin 1 0.000000288
Further Details:      
 
Domain Number 2 Region: 759-895
Classification Level Classification E-value
Superfamily I/LWEQ domain 2.16e-51
Family I/LWEQ domain 0.00000199
Further Details:      
 
Domain Number 3 Region: 665-789
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.01e-49
Family I/LWEQ domain 0.00000499
Further Details:      
 
Domain Number 4 Region: 2302-2493
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.38e-49
Family I/LWEQ domain 0.00013
Further Details:      
 
Domain Number 5 Region: 1847-1980
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 5.76e-44
Family VBS domain 0.0000102
Further Details:      
 
Domain Number 6 Region: 1231-1369
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.67e-39
Family VBS domain 0.026
Further Details:      
 
Domain Number 7 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.44e-31
Family Second domain of FERM 0.0000013
Further Details:      
 
Domain Number 8 Region: 1080-1213
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 3.45e-28
Family VBS domain 0.01
Further Details:      
 
Domain Number 9 Region: 312-403
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-19
Family Third domain of FERM 0.0000206
Further Details:      
 
Domain Number 10 Region: 1477-1563
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000824
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 11 Region: 1702-1822
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000628
Family VBS domain 0.061
Further Details:      
 
Domain Number 12 Region: 2012-2139
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000863
Family VBS domain 0.025
Further Details:      
 
Domain Number 13 Region: 81-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000799
Family Ubiquitin-related 0.048
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014298
Domain Number - Region: 1596-1667
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000235
Family VBS domain 0.046
Further Details:      
 
Domain Number - Region: 950-1048
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00294
Family I/LWEQ domain 0.005
Further Details:      
 
Domain Number - Region: 2142-2238,2265-2297
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00549
Family I/LWEQ domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014298   Gene: ENSTNIG00000011353   Transcript: ENSTNIT00000014496
Sequence length 2549
Comment pep:known_by_projection chromosome:TETRAODON8:5:2568356:2595427:-1 gene:ENSTNIG00000011353 transcript:ENSTNIT00000014496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVLSLKICVRQCNVVKTMQFEPSTAVYDACRIIRERVPEAQTGQASDHGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDILEYKKKQRPQKIKMLDGAIKTIMLDDSKTVGELLVTICSR
IGITNYEEYSLIQETVEEKKEDGMGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDESETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
GGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGAEKKIFQEHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVDERTKDVVQEWPLTTVK
RWAASPKSFTPGDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEE
STMLEESVSPKKRSTILQQQFNRVGRVEHGSVALPGVIRSGSIGTESLSMGTMPCAQQQI
TMGQMHRGHMPPLSSAQQALMGTINTSMQAVQKAQIDLDEVDNLPPLGQDMASKVWIQNK
MDESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLA
ALMEDDVGGGNDLMRAARTLAGAVSDLLKAVEPASGEQQPRQTVLTAAGSIGQASGDLLR
QIGENETDERFQDILMNLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALST
SQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVESCIQACLSATEDGELLKQVSAAASV
VGQALEDLLQHVRQYTARGEPIGRYDQATDTIMTVTESIFSSMGDAGEMVRQARVLAQAT
SDLVNAMRSDAEAEVDVDNSKKLLAAAKLLADATARMVEAAKGAAAYPENEDQQQRLREA
AEGLRVATNAAAQNAIKKKLINRLENAAKQAAAAATQTIAAAQNAAASNKNTAAHQQLVQ
SCKAVADHIPQLVQGVRSSQASPEDLSAQLALIIASQNFLQPGSKMVTSAKSSVPTVTDQ
AAAMQLGQCAKNLATCLAELRTSAQKAHEACGPMEIDSALTAIQTLRSELQDAKMAAVNT
QLKPLPGESLEKCAQDLGSTSKSVGSSMAQLLTCAAQGNEHYTGIAARETAQALKTLAQA
ARGVAASTTDPKAAAAMLDSARDVMEGSALLIEEAKQALVSPGDAESQQRLAQVAKAVSH
SLNNCVNCLPGQKDVDMALKSIGEASKKLLIETIPPASKSFQEAQNELNHTAEELNQSAG
EVVHASRGPSSQLAVASGKFSEDFDEFLDAGLEMAGHTQKKDDQVQVIGSLKNISMASSK
LLLAAKSLSVDPAAANAKNLLAAAARFRAVTDSINQLITLCTQQAPGQKECDNALRELEA
VRGMLDHPNEPVSDLSYFDCIESVMENSKVLGESMAGISMNCKNGDVAAFGDCVGSASRA
LCGLTEAAGQAAYLVGVSDPNSQAGHQGLVDPVQFAKANQAIQMACQNLVDPESSPSQVL
SAATIVAKHTSALCNACRLASSKTTNPAAKRHFVQSAKEVANSTANLVKTIKALDGDFSD
ENRNSCRVATAPLIEAVENLAIFASNPEFASVPAQISREGRTAQEPILQSACSMLDSSTH
LLKTARSLVINPKDPPTWSVLAGHSRTVSDSIKGLITAIRDKAPGQRECDSSIDNINKCI
RDIEQASLAAVSQNLPSRDDISLEALQEQLTSTVQEIGHLIDPVSTAARGEASQLGHKVT
QLAGYFEPLIKASVGVASKLKDHQQQMTFLDQTKTMAESALQMLYAAKEGGGNPKQAFHT
HDAIAEAAMLMREAVDDIMVTLNEAASEVGMVGMVDSITEAMAKLDEGTPSAPEGSFVDY
QTSMVKHSKAIAVTAQEMITKSVTCPDELGALASQVTGDYSQLAVQGRLAAHTAEPEEIG
FQIKTRVQDLGHGCIFLVQKAGALQITPSDSFTKRELIDCARVVTEKVSLVLSALQAGNK
GTQACITAANAVSGIIADLDTTIMFASAGTLNAENEESFADHRENILKTAKALVEDTKML
VSGAASGQDKLSQAAQSSAKTITQLTDVVKLGATSIGSDDPETQVVLINAVKDVAKALAE
LISATKCAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECI
KQELALFQSKDPPTKTTTPEEFIRMTKGITTATAKAVAAGNSARQEDIIHTANLSRKAMS
DMLSTCKQAAYHPDVSEEVKNRALMFGSQCATGYIDLLEHVLLVLQKPSAEFKQQLAVCS
KRVAGAVTELIQTAEAMKGSEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPK
QADETLNFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGLISANAEDDGQWSQGL
ISAARMVAAATSNLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAM
RRLQQIAGNAVKKASDNLVRAAQNAAFNKADDDNVVVKTKFVGGIAQIIAAQEEMLRKER
ELEEARKKLAQIRQQQYKFLPSELREDNN
Download sequence
Identical sequences H3D1B2
ENSTNIP00000014298 99883.ENSTNIP00000014298 ENSTNIP00000014298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]