SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014307 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014307
Domain Number 1 Region: 172-314
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-34
Family Third domain of FERM 0.0031
Further Details:      
 
Domain Number 2 Region: 66-174
Classification Level Classification E-value
Superfamily Second domain of FERM 2.22e-31
Family Second domain of FERM 0.0000963
Further Details:      
 
Domain Number 3 Region: 2-66
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-22
Family First domain of FERM 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014307   Gene: ENSTNIG00000011362   Transcript: ENSTNIT00000014505
Sequence length 552
Comment pep:known_by_projection chromosome:TETRAODON8:5:2394870:2401736:-1 gene:ENSTNIG00000011362 transcript:ENSTNIT00000014505 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRDAKGQYLFDLICHHLNLLEKDYFGIRYVDPDKQRHWLEFTKSIAKQMKSQPPFTMCLR
VKFYPPDPVALKEEITRYLVFLQVKRDLYHGRLLCKTSDAALLAAYILQAEIGDYDPGKH
PEGYCSKFQFFPKHSEKLERRIAEIHKTELIRRGQCPETSELNFLQKAQMLETYGVDPHP
CKDVSGNPAFLAFTPFGFTVLQGNRRIHFLKWDEVTKLKFEAKTFHIYANQNEDRKIILT
YFAPTPEACKHLWKCGVENQAFYKLEKSSQVRTVSSSNLFFKGSRFRYSGKVAKEVMEQS
AKIKRDPPEIHRSDFFLKRPCVTCRMAHSLNYGQVFDPDPDEGERSPAHGKPLLPRCEGL
ESLRDSAHSTPVRSVSHSDSFMSSQGHMADSGEVSASGVISDEAYSPSDSVLPTPVAEHG
AEVPPARHLNGAPCSVDEEDSEAAAAPKEGQRGDCGRRGLGLVRRRPPPPSEVQELNKFM
LSVLRLFLVTMGLLFALLLLLIVLTESELDIAFLRDIRKTPEFQQFHFEYFCPLRRWFAC
KLRWMGGFLISK
Download sequence
Identical sequences H3D1C1
ENSTNIP00000014307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]