SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014313 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014313
Domain Number 1 Region: 26-509
Classification Level Classification E-value
Superfamily Sema domain 1.44e-161
Family Sema domain 0.00000000119
Further Details:      
 
Domain Number 2 Region: 505-555
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000196
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014313   Gene: ENSTNIG00000011368   Transcript: ENSTNIT00000014511
Sequence length 829
Comment pep:known_by_projection chromosome:TETRAODON8:5:2294363:2304225:-1 gene:ENSTNIG00000011368 transcript:ENSTNIT00000014511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRRRLRTALIGFPCILLCDDNRVCVSLLLPDAKERLAKRFSVDGVFNYTSLLLSQEDDML
YVGAREELFALSLSDISKTKLQKNLKWGTPAGKREECSFKGKNLETDCFNYIKILLRLNS
THLYVCGTFAFSPVCAYINTSSFTLERDEAGEVAMEDGRSRCPFNPEYKSTAIIVDGELY
TGTVSNFQGNEPVIYKSLGQGAALKTENSLKWLQDPVFVGSAYIEESQPMGNPVGDDDKI
YFFFSEVGKEFDFFDNTIVSRIARVCKGDKGGERVLQKKWTTFLKAQLLCSLPDDGFPFN
IIQDMFVLKPTGDSWESTVFYGVFTSQWYRGASGSSAVCAFTMAQVERAFSSRYREVNRE
TQQWYTYNHPVPEPRPGACVTDQARRMGIHSSLQMPDKVLNFVKDHFLMDSVIRSSPLLL
KRSVRYTQIAVHKIQGMERAYDVLFIGTDDGKLHKAINANDKMHIIEEVVLFPGSEPVQH
IELDPQRGLLFVSSNSGLVELPVANCSNYPSCGECVLSRDPYCAWTGRVCQDVRMAPPDS
HWQQDVEEADTAAICNRTSLSPRAARPAASRGSRCQAVSIPANTFRVLPCPLRSNLAQRR
WRYRAGASHFLHATPEGSLLVVAQAGRTETYECWSEEQGFRQLLANYCVAAEPRQQSSTT
PRAAPRTPHVEQEESVVLPGVFRSEQVHAKTYWNELIAVCGLLALSLVAFSLFVLYRNRD
HMKSMLKPGECPPGAPQKKPRMAGKPAESLPLNGNPIPVSTSDHKGYQTLNDNYICSTPT
HESSPENSKSFSEASDRRPLNVKETRVEYSPTCPRPRVRLGSEIKDSIV
Download sequence
Identical sequences H3D1C7
99883.ENSTNIP00000014313 ENSTNIP00000014313 ENSTNIP00000014313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]