SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014317 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014317
Domain Number 1 Region: 47-191,225-382
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.44e-85
Family NAD kinase-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014317   Gene: ENSTNIG00000011372   Transcript: ENSTNIT00000014515
Sequence length 396
Comment pep:known_by_projection chromosome:TETRAODON8:15_random:2973465:2983055:1 gene:ENSTNIG00000011372 transcript:ENSTNIT00000014515 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRAHFLHGPYPATHFGPKACILPNPTSVMHIQDPASQRLTWNKPPVNVLVIRKIRDESLV
EPFKELCRFLVEEKRMMVYVERRAADDAALLKDESFGAVRNQLCTFREGYDDISDCIDLI
ICLGGDGTLLYASSLFQGSVPPVMAFHLGSLGFLTPFKFDSYKTEVAKVFEGNAAITLRS
RLKVKVVKDVLQRAEQQPHGRETPQQEHNGQLPHGPASSEFGKVTLQLQQVLNEVVVDRG
PSSYLSNVDLYLDGRLITSVQGDGVIVSTPTGSTAYAAAAGASMIHPNVPAIMVTPICPH
SLSFRPIVVPAGVELMITLSPDARNTAWVSFDGRKRQEIQYGDCIKITTSCFPVPSICCH
DLVYDWFESLAECLHWNVRKRQARLADASDSSDTDN
Download sequence
Identical sequences H3D1D1
ENSTNIP00000014317 ENSTNIP00000014317 99883.ENSTNIP00000014317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]