SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014324 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014324
Domain Number 1 Region: 38-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000812
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 2-34
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000127
Family LDL receptor-like module 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014324
Domain Number - Region: 85-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00089
Family LDL receptor-like module 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014324   Gene: ENSTNIG00000011379   Transcript: ENSTNIT00000014522
Sequence length 140
Comment pep:known_by_projection chromosome:TETRAODON8:13:6013122:6020588:1 gene:ENSTNIG00000011379 transcript:ENSTNIT00000014522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGNFMCADGKCVPGGWQCDGFPDCFDESDEKGCPKFKSKCAPTFFACANGVHCIIGRFRC
NGFSDCPDGSDEENCSKMSCNSNPLLCSETRFKCRNAMCQDNCQDNSDEELCLTTAVGCG
KTAFSLEVALTLPASVICRN
Download sequence
Identical sequences H3D1D8
ENSTNIP00000014324 ENSTNIP00000014324 99883.ENSTNIP00000014324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]