SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014361 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014361
Domain Number 1 Region: 452-475
Classification Level Classification E-value
Superfamily Notch domain 0.000085
Family Notch domain 0.0026
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014361
Domain Number - Region: 952-994
Classification Level Classification E-value
Superfamily EF-hand 0.00447
Family Penta-EF-hand proteins 0.065
Further Details:      
 
Domain Number - Region: 1040-1086
Classification Level Classification E-value
Superfamily PTS-regulatory domain, PRD 0.0183
Family PTS-regulatory domain, PRD 0.032
Further Details:      
 
Domain Number - Region: 513-541
Classification Level Classification E-value
Superfamily Notch domain 0.0209
Family Notch domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014361   Gene: ENSTNIG00000011416   Transcript: ENSTNIT00000014559
Sequence length 1207
Comment pep:known_by_projection chromosome:TETRAODON8:19:2028085:2036578:-1 gene:ENSTNIG00000011416 transcript:ENSTNIT00000014559 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVVNSVLKLVQRQTYTCLSHRYGLYLCFGGLVLMIVSAFQFGEVVLEWSRDQYHVMFDS
YRDNLGGKSFQSRRLCLPMPIDVVYTWVNGTDVTLKELKAVREQMEEEQRALREHLERNA
SEITEVPKGSVKPECLLSHCIVAPMLALEPALPANVTLKELPTLSQAFSAAKELLTLSKP
SQPSATASVVVFHSQAEADKAYMDTLKENQKSSVSRCYLTTDKEAPGLIRMHSLAYLSGF
PASFKETEQLRVKLPTAVTNKISQLELYSEASIALLHLKTLQDFPELAQQAKKNLTLDGN
ELAISPTYLFWDLAAISQSKQDEDVSASRFEDNEELRYSLRSVERHAPWVRHIFIVTNGQ
IPSWLNLDNPRVTVITHQDIFQNHSHLPTFSSPAIETHIHRIPGLSQKFIYLNDDVMFGK
DVWPDDFFTHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCLGAAA
NRFAAGIAGGGGGPVWQFPGASGGLGGTSYCNQGCANSWLADKFCDQACNVLACGFDVGD
CGQEHFGELHRVTLQSHQTVYILPVGEIKPYFSFEGLARRVSEASVSDSAVLRHTSVANK
WKTVHLLLHPGHNATQIHYNLTLQKEDGSEFTMSFSVAVDTREVPQANVSQSTSKDEDKT
PKPTATPEPPVLFSDVPEDKRGPKIHTKQPDDLQAVIQVPSVDVSLLPADVQSELQRLEE
KLVVGDITLKGFNLTKAELLKAHLPPRLSQPDSQSHPVDIQEKERTDDKRNTVATLRPLP
IDDDLKKDFAAPKHPGVGAPLERPLTSKLLNSISKVRSVKSPSEDAAAVVGRRLQHFISA
DRGFLPWERRKYFQRVLEEEERLQNELLYESNPSATVRRLRDTFADSLRYVNKLLNGQFG
FTSRKVPAHMPHMIDRLIMQELQDTFPLEFDKTSAHRVRHSEDMQFAFSYFYFLMSAQQQ
LNVSDVFDEVDTDHSGVLSDREIRTLATRIHELPLSLQDLTGLEQLLINCSKTLPTNLSQ
LHLVNPTQETYYDPSMPPVTKGLILHCKPMAERIHKAFKDQNKYKFEIMGEEEIAFKMVR
TNVSHVVGQLDDIRKNPRKFICLNDNIDHSHKDAATVKAVLRDFYESMFPLMSQFELPRE
YRNRFLHMEELQEWRVYRDKLKFWTHCVLVTLVVFTIVSFFAEQLIQLKRKLLPRRRANR
DSNPERV
Download sequence
Identical sequences H3D1H4
99883.ENSTNIP00000014361 ENSTNIP00000014361 ENSTNIP00000014361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]