SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014367 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014367
Domain Number 1 Region: 14-303
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.26e-66
Family FCH domain 0.0047
Further Details:      
 
Domain Number 2 Region: 411-475
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000171
Family SH3-domain 0.00084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014367   Gene: ENSTNIG00000011423   Transcript: ENSTNIT00000014566
Sequence length 477
Comment pep:known_by_projection chromosome:TETRAODON8:19:2068468:2075292:1 gene:ENSTNIG00000011423 transcript:ENSTNIT00000014566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGSYDDSINDVSSDSFWEVGNYKKSVKRVDDGNRLCNELMNCIHERARIEKAYAQQLTE
WGKRWRQLIEKAGPQYGTLERAWTSLCTEAEKVSELHMEVKAALMGEDFEKLKNWQKDAY
HKQMIGGFKETKEAEDGFRKAQKPWAKKLKEVEAMKKSYHTACKEEKLAASRETNSKLES
NNPEAQKKLQEKLEKCQQEVQKTKERYEKSLEELDKLTPQYMENMEQVFEQWQQFEDKRI
RFFREVLLEVKQHLDLSTNHRFQTIYHTLEDTISATDAEEDLKWFRTNQGPGMPMNWPQF
EDWSMDLNRTLSKREKKRPSEGVHLTGISQTGSDQPVQPAKSSSSLNTPAKTAPAGSNPV
KQQTTVSHIIVNKEDLKTCSAGSAEKTPDWSDEDSSGNPFSANGNGNPFEDEPTSPVISV
PVRALYDYEGQEQDELSFKAAGYEFTKIGEEDDQGWCKGRLKDGQIGLYPANYVEDI
Download sequence
Identical sequences H3D1I0
ENSTNIP00000014367 ENSTNIP00000014367 99883.ENSTNIP00000014367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]