SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014371 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014371
Domain Number 1 Region: 9-252
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.92e-54
Family Ankyrin repeat 0.000065
Further Details:      
 
Domain Number 2 Region: 872-1030
Classification Level Classification E-value
Superfamily PH domain-like 3.81e-46
Family Phosphotyrosine-binding domain (PTB) 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014371   Gene: ENSTNIG00000018849   Transcript: ENSTNIT00000014570
Sequence length 1131
Comment pep:known_by_projection chromosome:TETRAODON8:19:2129479:2186815:1 gene:ENSTNIG00000018849 transcript:ENSTNIT00000014570 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LCSMWKGLNVNCTDSSGYTPLHHASLNGHRDVVLKLLQYEASTNVEDNKGCFPLHLAAWR
GDVDIVRILIHHGPSHCRVNQQRPSANVLTLEEGREAGSLPPSVLPQNHEKETALHCAAQ
YGHSDVVSVLLHELTDPTMRNSRQETPLDLAALYGRLEVVCMLINTHPNLMTCHCRRHTP
LHLAARNGHHSTVQTLLQAGMDVNCLTDNGSALHEAALFGKMDVVRLLLDSGIKTNLRDS
QGRTALEILREHPAQKSQQITALIQGCHCTGTNDPLIGDQKGHARTPTPTRTYAALPLSD
DAVTSELSKLLHEIKKCRDRDYSFEELCQTISSHSMDSFGSGRLSDEERPDRPNGTLTRV
FKPEGLQRPTPPVAPALEEDEAEKSDPKYSSEIVTSPSLDVFLPEDEDNPYESVTTAVTR
KPCSLDISHRLNACPGNERNRSAEDRRKSHIPEEFAGLLHGSSPACETLETPYHLYSPKP
HSYASTDPQSGLLQAPEFSVVIGGGPRHPFSRTGAESNPGQTEKPQVVYRTIFHTQVNQG
SGYEERACTLGRMRSMPRSVLDLQLSKSLSKSDSNLVAVSPIQEEHSWGSGSREHGAGSL
SPGEGTSPGGRLERTPSFTAEWEEIDKIMSSIGAGIRSGLDFKEENSGSRASRMYGEGRA
GWRSTIWLQKHTDECSAPAFMNDKFQGSNVVEDQDLREGGMNMQASKQRWGSGVQLPRLE
RGLEPEGSLCWLASSHQHPFIFPHAMSCCGSVAMVTVELEAEAATVVEVLKISLIGHRKR
ILASLGDRLHEDTPQKPPRAISLREPGNQTPPQLSPSVGQAAYTAGVPGGSLDVQHLIMQ
ADARRRQRSNDNYFEDVPRSKLERQMAQAGEWCEPITLRPPNEATSSTPVQYWQHHPEKL
IFQSCDYEAYYLGSMLVKELRGESTQDACAKMRKSTEQMKKVPTIVLSVSYKGVKFIDAT
NKNIIAEHEIRNISCAAQDPEDLSTFAYITKDLKSSHHYCHVFTAFDVNLAYEIILTLGQ
AFEVAYQLALQARKSGHGSSTLPESFDSKPSKPVPKPRVNIRKSVIMSPSSRWSLGHIYT
PHRPPLHPCLPPTRMEQPSMDQKGHANVPWIVEPGQEAKRGVNTKYETTIF
Download sequence
Identical sequences H3D1I4
ENSTNIP00000014371 99883.ENSTNIP00000014371 ENSTNIP00000014371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]