SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014380 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014380
Domain Number 1 Region: 358-616
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-36
Family YWTD domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 242-353,611-652
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 195-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000668
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 42-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 118-151
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000089
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 6 Region: 3-41
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000126
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 86-118
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000877
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 8 Region: 160-191
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014380
Domain Number - Region: 235-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00451
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014380   Gene: ENSTNIG00000011435   Transcript: ENSTNIT00000014579
Sequence length 656
Comment pep:known_by_projection chromosome:TETRAODON8:12:11490924:11494570:-1 gene:ENSTNIG00000011435 transcript:ENSTNIT00000014579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPLKCNLGSQLCSDGSECVRTQHLCDGESDCRDGSDEENCQTTCNNDQFQCAHGRKCIGK
DQVCDDMPQCQDGSDELGCVKQTDVCHHHCDNRSRCLPAKFLCDGEWDCLDGTDEANCDQ
FQCAHGRRCIERDQVCDGVPHCQDRSDELKCSRMMEGCDHQCDDMSRCIPETFLCDGEGD
CQDGSDEANCVDKDCGPAEFKCTSGQCVSSVMRCDGHPDCWDQSDEESCTSGAKLCLPHQ
FQCSSQECLEPALVCNGFINCADGSDEGGSCQTTCTEDEKSGCSQSCYSTPQGTRCHCAA
GYRLMEDGRTCVDVDECEGPDVCSHLCINSPGSYHCDCHPGYVMEANGHHCKIRGEPLLL
TSIQTDLFLLGLRSGSLDVLSSAAKKAILSVDYDWEEQRVFWVTVDTDSIRWSSLDHKTT
GTLIKGIRADSVAVDWLGRNLYWIDGVNSQIVAIRLKKNTVESLAHSVILDEDLDQPRSL
ALLPQKGLMFWTEIGNVVKIERAGMDGSERRAVVNSSLGWPGGVAVDAIAERVYWADERL
GAIGSAMLDGNDIRILQTKETLNPFSLVVFNDMMYWTDAKKRVVRSARKVSGKNGHILLK
RQRQPFGVKIIHPLLQTSVESPCAKKCSHMCVLAPGPRAVCKCPFGLLLAEDGLSC
Download sequence
Identical sequences H3D1J3
ENSTNIP00000014380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]