SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014381 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014381
Domain Number 1 Region: 479-737
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-36
Family YWTD domain 0.0000322
Further Details:      
 
Domain Number 2 Region: 426-473
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000251
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 235-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00084
Further Details:      
 
Domain Number 4 Region: 156-193
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000223
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 5 Region: 38-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000055
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 6 Region: 352-389
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000838
Family LDL receptor-like module 0.0027
Further Details:      
 
Domain Number 7 Region: 400-439
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000111
Family EGF-type module 0.022
Further Details:      
 
Domain Number 8 Region: 315-352
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000122
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 9 Region: 113-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 11 Region: 83-114
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000615
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 12 Region: 278-311
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000759
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 13 Region: 202-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 14 Region: 785-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000877
Family EGF-type module 0.051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014381
Domain Number - Region: 747-779
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000565
Family EGF-type module 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014381   Gene: ENSTNIG00000011435   Transcript: ENSTNIT00000014580
Sequence length 840
Comment pep:known_by_projection chromosome:TETRAODON8:12:11489072:11494558:-1 gene:ENSTNIG00000011435 transcript:ENSTNIT00000014580 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CNLGSQLCSDGSECVRTQHLCDGESDCRDGSDEENCQTTCNNDQFQCAHGRKCIGKDQVC
DDMPQCQDGSDELGCVKQTDVCHHHCDNRSRCLPAKFLCDGEWDCLDGTDEANCAPIRCA
FHSKPCKNEMECVHHIHFCDGEVDCSDGSDEEDCTLICEADQFQCAHGRRCIERDQVCDG
VPHCQDRSDELKCSRMMEGCDHQCDDMSRCIPETFLCDGEGDCQDGSDEANCDKDCGPAE
FKCTSGQCVSSVMRCDGHPDCWDQSDEESCTTEQVCTTKLRCPQSKECLVQEWICDGDQD
CKDGTDEKDCPVTPLSCGEFQWSCVSKTQCISTAWRCDSTEDCDDRSDETKCGAKLCLPH
QFQCSSQECLEPALVCNGFINCADGSDEGGSCQTTCTEDEKSGCSQSCYSTPQGTRCHCA
AGYRLMEDGRTCVDVDECEGPDVCSHLCINSPGSYHCDCHPGYVMEANGHHCKIRGEPLL
LTSIQTDLFLLGLRSGSLDVLSSAAKKAILSVDYDWEEQRVFWVTVDTDSIRWSSLDHKT
TGTLIKGIRADSVAVDWLGRNLYWIDGVNSQIVAIRLKKNTVESLAHSVILDEDLDQPRS
LALLPQKGLMFWTEIGNVVKIERAGMDGSERRAVVNSSLGWPGGVAVDAIAERVYWADER
LGAIGSAMLDGNDIRILQTKETLNPFSLVVFNDMMYWTDAKKRVVRSARKVSGKNGHILL
KRQRQPFGVKIIHPLLQTSVESPCAKKCSHMCVLAPGPRAVCKCPFGLLLAEDGLSCSSL
VDSAFRRRCSDNGRCVEIDGETACVCSPSYRGDSCQDHVLKTMQGPIVYGASGLCVAMVI
Download sequence
Identical sequences H3D1J4
ENSTNIP00000014381 ENSTNIP00000014380 99883.ENSTNIP00000014381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]