SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014402 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014402
Domain Number 1 Region: 941-1001
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000855
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 2 Region: 1022-1152
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000132
Family Pleckstrin-homology domain (PH domain) 0.037
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014402
Domain Number - Region: 786-873
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00445
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 103-333
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014402   Gene: ENSTNIG00000011455   Transcript: ENSTNIT00000014601
Sequence length 1609
Comment pep:known_by_projection chromosome:TETRAODON8:12:11689691:11707464:-1 gene:ENSTNIG00000011455 transcript:ENSTNIT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVEQEISLVQRKMSDLESVLQQKDIELKASETQRTILEQDLATYITECSSLKRSLEQARM
EVSQEDDKALQLLHDIREQSNKLQEIKEQQEYHAQLEEMRVSIRQLEEDLSAARRRSDLY
EAELKESRQSGEELKRKAADYQHRIQKAKEQGKSEAEDLMSRLEQTNAEQQTKIQDLQEK
LSKSLKASAEATDLLQSMKVAKERLERDLERLQNKEDSSDSLRRRLRETEDGRKTLENQV
KRLEIVERREIKLKDEIQSKSQQIQQMADKILGLEENLRESQATAQRLETHLKQKEKLYE
DKIKVLEAQMKADMADKEMLESSQSKYEEEVREKCSIISEQKATINAMDSKMNSLEQRLA
ELSEANKLAANSSIYTQKNMKAQEEMISELRQQKFYLESQAGKLEAQNAKLEEHLEKMSQ
QEQSNKSRVLELETRLREIGLEHEEQKLEIKRQVTELTLSLQERESQISNLQAARHALES
QLQQAKTELEETTAEAEEEITVLRAHRDEIQRKYDALRDSCAVITDLEEQLTTLTQENAE
LNRQNFYLSKQLDEASDEREDRLQLSQDVDRLRREVADREMHLNNQKQNLETLKTTCTML
EEQVLELETLNDELLEKERQWEAWRAALEDEKSQAERRTREVQRLLDTEKQSRLRAEQRS
SESRQAVEQAVKEHKNEILALQQALKDQKLKAESLADTLNDLEKKHAMLEMNARSLQQKL
ESERDLKQRLLEEQEKLQQQMDAQKTHIFRLTQGLQDALDQTDLLKTERTDLEYQLENIQ
AVYSHEKVKMEGTITQQTKLIDFLQSQAHGGSKKKKGLFGRRREDASPAPPVQPVPLQYS
DMKAALDKERARCSELEDALQKMRAELRSLREEALQYKDLSNPANPASARQQMLMSSIKS
PEHQQGPTSLAPSNSGRRKEAATPEEFSRRLKDSQRDRDRERAGHHSTAHRFTVGLNMRA
AKCTVCLDTVHFGRQAATCLECHALCHPKCSPCLPSTCGMSSDCSLHLSEALCRDKMGSA
GPPLKEAGGHMHLEGWMKQPRNGKRGQGWERKYVVLDGTKVSIYDIEPREDSVKPLEEFD
LCLSDGEVIVHGAVGASELPNTSKSDVPYVLKLEARCHTPCWPGQSLYFLAPSFPDKQRW
VAVVESVVAAGRASREKAEADAKLLGNSLLKLEGDDRLDINCTLPLTDQIVLVGSEEGLY
ALNVIKNSLTHVPGLGSVFQIHIIKEQEKLLMIVAGDERALCLVEIKRVKQTLAQPHLAG
QAELAPYIFETVKGCHLFAAGRIDNGPCICAAMPNKITILRYNDNLNKFCIRKEIETLEP
CSCIHLTGYSAIIGTNKFYEIEMKQFALEEFLDKNDLSLASAVFAASIHSFPIAIMQVAS
VLQKEEFLLCFHEFGVFVDAYGRRSRTEDIKWSRLPLSFAAYREPYLFITYFNSLDVIEI
QGHASLGVAVLAHLDIPNPRYLGPAISSGAVYLASSYQNKLRVICCKGSLIRESGELQRT
GSSRGSPTKRGPPTYTEHISKRLTSGPGSHDSGLHREPSTPHRYREGRTEFRRDKSPARP
LDREKSPGRMIDSRRERSPGRFSDGTRLHTGSVRTQLAPVNKVWDQSSV
Download sequence
Identical sequences H3D1L4
99883.ENSTNIP00000014402 ENSTNIP00000014402 ENSTNIP00000014402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]