SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014413 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014413
Domain Number 1 Region: 54-214
Classification Level Classification E-value
Superfamily E set domains 1.11e-53
Family RhoGDI-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014413   Gene: ENSTNIG00000011466   Transcript: ENSTNIT00000014612
Sequence length 218
Comment pep:known_by_projection chromosome:TETRAODON8:12:11797315:11798991:1 gene:ENSTNIG00000011466 transcript:ENSTNIT00000014612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKAGGGMLKKLKSRRSQTEKWPAVTEDELRALGSSITPDHVLGLRAITEDYLCKAEDNVY
NVDFTRFKIRDLETGTVLFEIAKPPGSAPVDSEEDGLDVDASAGRFVRYQFTPAFLKLCT
VGATVEFTVGDRPINSFRMIERHYFQGRLLKSFDFDFGFCIPNSRNTCEHIYEFPQLPDD
LIRQMVARPYETRSDSFYFVDNKLIMHNKADYAFNGGL
Download sequence
Identical sequences H3D1M5
ENSTNIP00000014413 ENSTNIP00000014413 99883.ENSTNIP00000014413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]