SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014417 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014417
Domain Number 1 Region: 171-263
Classification Level Classification E-value
Superfamily AMPKBI-like 1.01e-34
Family AMPKBI-like 0.00001
Further Details:      
 
Domain Number 2 Region: 68-152
Classification Level Classification E-value
Superfamily E set domains 6.53e-25
Family AMPK-beta glycogen binding domain-like 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014417   Gene: ENSTNIG00000011470   Transcript: ENSTNIT00000014616
Sequence length 263
Comment pep:known_by_projection chromosome:TETRAODON8:12:11817620:11819515:1 gene:ENSTNIG00000011470 transcript:ENSTNIT00000014616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSSSGGSSGAPGDRYREGGKEARAKILLDTTEDGDPDPKAPQEIQEFLAWQQDLESDT
KGPGSQARPTVFRWSGPAKEVFVSGSFNNWATKIPLNRSQNNFVAIVDLPEGEHQYKFSV
DGHWMLDPNGAVATSRTGVVNNTIQVKRTDFEVFDALRIDSEDTADVSGTDLSSSPPGPY
QQEAYLLRPEDKLKQPPVLPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDG
VMVLSATHRYKKKYVTTLLYKPI
Download sequence
Identical sequences H3D1M9
99883.ENSTNIP00000014417 ENSTNIP00000014417 ENSTNIP00000014417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]