SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014438 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014438
Domain Number 1 Region: 31-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.19e-31
Family Ankyrin repeat 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014438   Gene: ENSTNIG00000011491   Transcript: ENSTNIT00000014637
Sequence length 180
Comment pep:known_by_projection chromosome:TETRAODON8:12:11959634:11960875:1 gene:ENSTNIG00000011491 transcript:ENSTNIT00000014637 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTPGDHRCSCCSGPVSSVHQTLHEMDFERGIWSAALHGDLQRVRSLVQKGTQPNLKDTA
GYTAQHYASGGGHVAVCAFLLEVGACASPQTPGGATLHRAAYCGHVDVVGLLLEHGANPS
LRDGDGATPLHKAAARGHREVCGLLLQSCPTLCSVTDNKLQLPFVDVLPNNSGCSSLTKA
Download sequence
Identical sequences H3D1Q0
ENSTNIP00000014438 ENSTNIP00000014438 99883.ENSTNIP00000014438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]