SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014448 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014448
Domain Number 1 Region: 12-222
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.27e-49
Family IMD domain 0.00019
Further Details:      
 
Domain Number 2 Region: 314-392
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000249
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014448   Gene: ENSTNIG00000011500   Transcript: ENSTNIT00000014647
Sequence length 471
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:6519739:6528264:-1 gene:ENSTNIG00000011500 transcript:ENSTNIT00000014647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSRPHSDTTALKDQREQNLVDDFNPSLQKLVLLGNSYIQAFRAFTSTSDAYFGALSKIGE
KALHTVSSRSLGEVLMQISESQRRFTMELEGVLQWFSVEVIRQMDNNTRQDRSFISDSRK
YYEMEVHNKATALERQLWRGNSRVGRPAFHCLSVHLFSLSGQDQGEYLQFLQRSNEEALQ
EEERRHRFLAEKHCGLVQSITYLMNKTGSSLQQKVDSWTKDVSATREPEAEQRPSVSNSF
AASLLHSHDKLLQHQHRHHNRTQVGMREDNFRMAREQQRLDREESPLGNVPSRAPSPQGS
LPQALGEAAAGVGRTMRARVSHQPTASNRTLLPFSKGERITVLVPQARKGWLYGQAESST
QQGWFPASFAEAVDDPPPQVTVSRNSSNSSFSSLADQPWSRRQSDATPPPPPPLVDTDRG
PPLSPLVSSEDQTLPDRDRNSSPVYFRRGTNPFATVKLKPTTTDDRSAPRL
Download sequence
Identical sequences H3D1R0
ENSTNIP00000014448 ENSTNIP00000014448 99883.ENSTNIP00000014448

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]