SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014449 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014449
Domain Number 1 Region: 303-493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.96e-33
Family Pentraxin (pentaxin) 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014449
Domain Number - Region: 193-278
Classification Level Classification E-value
Superfamily PspA lactotransferrin-binding region 0.0131
Family PspA lactotransferrin-binding region 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014449   Gene: ENSTNIG00000011501   Transcript: ENSTNIT00000014648
Sequence length 508
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:6530604:6534511:1 gene:ENSTNIG00000011501 transcript:ENSTNIT00000014648 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAATLKFIVVILAAGMVAFIGAVICIIAAVHTGSSRSAAAQRQPAADNHSLYPDSAAQTP
AAAVGSLGALHGSEAPTYNIGLGGLDGVTGLSGHDPTVSRLICTPIPAGECNPKNFQQQA
EDPSLYSGEDWGHLRNTAEELRQTVLQQKDQIQTDQRTIRELTGKLSECEKGQDGWSSAD
DSPDLSSDGVHLLTIRAVDELEQAITQLKDRIERLETEVGGKSGDPEGLVAGAIPDRTWN
VEDVEGELERKLELLDKNRKALKLETEKHRQEIDHGVDKLPPSDRGTGGSLSAGMLGPSF
PEGFRLSFPTRTNYMYAVVERPVPELRAFTFCMWLRPTEGGIGTPLSYAVPAQPNELVLL
QGLHTPTELLVDDKVAQLPLNLSRGSWQHICVSWSQKGGIWQAFQGGKLRGEGHSLAAGH
HIRPGGVLVLGQEQDSLGGGFDSSQALVGELSQVGLWDRVLPPSQVASLARCGRVHQGSV
VSWTESKVEIHGGAAKEAGEPCTKHNRS
Download sequence
Identical sequences H3D1R1
ENSTNIP00000014449 ENSTNIP00000014449 99883.ENSTNIP00000014449

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]