SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014456 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014456
Domain Number 1 Region: 13-729
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.55e-251
Family Motor proteins 0.000000000726
Further Details:      
 
Domain Number 2 Region: 1637-1723
Classification Level Classification E-value
Superfamily SH3-domain 0.000000205
Family SH3-domain 0.0023
Further Details:      
 
Domain Number 3 Region: 2081-2193
Classification Level Classification E-value
Superfamily Second domain of FERM 0.0000942
Family Second domain of FERM 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014456
Domain Number - Region: 2194-2284
Classification Level Classification E-value
Superfamily PH domain-like 0.00134
Family Third domain of FERM 0.051
Further Details:      
 
Domain Number - Region: 1993-2077
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0186
Family UBX domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014456   Gene: ENSTNIG00000011507   Transcript: ENSTNIT00000014655
Sequence length 2309
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:6724798:6741430:-1 gene:ENSTNIG00000011507 transcript:ENSTNIT00000014655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSIRSLPSMSHWEQREEDGVDDMTQLKDLQEGAVLQNLKKRFEREIIYTNIGSILVSLN
PYKMYNIYGTDQLLLYKGCALGENPPHLFALANAAYSKMMDAKHNQVIIISGESGSGKTE
ATKLVLRYLAEIYYHKSSIAQQIEILEAAPLLESFGNAKTVRNDNSSRFGKYIEVFLEDG
VISGAITSQYLLEKSRIVFQANNERNYHIFYEMLAGLPLQQKQAFYLQDAETYYYLNQGG
DCGIPGKNDSEDFLRLLAAMENLRFTAEDQSAIFRVLSSILHLGNVYFQSHEADGQEVAS
VVSAQEIRVVAELLQISPEGLQKAITYKVTETMREKIYTPLTVESAVDARDAVAKILYSL
LFHWLTEKINAQVYPHQHTTSISILDIYGFEDLAFNSLEQLCINYANEYLQFFFNRIVFK
EEQEEYNREQIPWQDIPFGDNQPCIDLIAAKPHGILRILDDQSCFPQATDHTFLQKCHYH
HGNNPLYLKPKMPLPEFTIKHFAGQVTYQVYKFIDKNFDQVRQDVLDLFIQSKNKVKKQE
RWSRTTPNENKKVTDTICHQHFRCNTFFVRCIKPNNMKKPGVFDDDLVSSQLKHSGVLET
IRIRRQGYPVRMPFCVFLFRYKSLVGMNQLPTANGETCVSLLSKLCPLSPGSYHVGVTKL
FLKEDIYQMLEYKRERMRHLAALTLQRYARMFFVRERYLAFRKKIVWLQAQCRGFLTRKR
YMKMQQSVFQFRSLVHMYITQKQYIKELSRREVVNVTHLVIPAELGALLQTAGVRRELHS
DCLALLQAPHIQEEAQLKLPLDINNYPFYRYVQIYFREPKFGMLMETLKSPLTRLEDVLC
KEALELFNMVLRFMGDPHLNGAQENMFGNYIIQRGLSSPGLRDEILAQVVNQVWRNVNSD
NAERGWLLLLACVCSFAPSPRMDKYLLKFVSDHGPAACQALLQHRLIQAGQKTQLGSGSA
PEAARTYPLSLLEWTANRKKANMALHVHCFDGASFLCPVHSWTSGEDLGGNILRHRGVSD
WWRGSSILMKEHGQWVELAGHDYVMDLIADLELPTDFPKHKSYFIISSDDPAKVRANAGL
ALFGSGFDSDDELPSAFPLGAGDSSRPAYSLPDSDGYFSHGTHRSFFVTVFLSLVESDAL
SDGQAQRGMDRYLDSLFDPVLSDSNMAVMEKTGSLSARMKGGGGIGITGGGRGEEDTHQS
ASRPYPPGIHPGGSEQAILTQQQQAIINQQAIILAQQMTMQAIAIQQQMLSSFPPMSPAP
SSPPLRRRHVHSPVTLTPLPADQRNGTITVQSCCSSTKNEYVDVFAQLIEYKRKITGLAR
EDVVQSSPTNAEHMDPSHTIKDIIKQHQPASTSTPTGAAPHRKGDGRMFVKKPDPHDEAM
EILKDQMTSPPKPVHTPVISNTYTPAHASTQGLEKRIKLGCKWVFPVSRELPVEEEIIQT
QLHSRTSEEYYTYSNVPWKLYMRKEVFYPKENLNNPLLLDLIFQQVVHDTFSEACIRITQ
VERQKMKDLLAENKVDPVAGIQDDNVKKKVVTMARDSWEIYFSRLFPASGSVGTGVQVLS
VSHKGIKLLKMVRSSSTAPGLLQSAEALQCSYSDILFVSIPSKNMLEFNLTNEKLILFSA
KAPQVKHMIDYFLTEIKKDSEYVVAVRNYINEDRALLNFHKGDIIRLQRVDGLEAGKHYG
CIVRKKVMLLEELKRDTSEFGWRFGAVYGKSGVFPSEYVHPVAAPDFLVLPPDRAEPRDR
QGQVAASAAIAVAMGSSVAAQELDLSTEVVHDIYGDNESIILDEVNLHGGQYHMSEFAKN
YFRDAQFDRRNQKTKKGKECRDPADMVKFSKSPIQESLIDFSDGGINRMATDIFLAIMRF
MGDAPLRGQQEQDLVTTVLKLSGAHGLIKDETYCQLMKQVTANTSSKPDSCQRGWRLLYI
LTAFHRCSDVLKPFLLKFLQDACASPTNQYQSIAKACEQNLRRTFQYGGRVQCPNNMELR
AILAGRSSKRQLVLLPGGIERHLKIKTCSVALDVIEELCYEMELHRPEALDEYAVFLVTH
RGQNVRPLNKREYILDIATEAETVDANYSLWFRRVVWSLALKLDNELYVSMHYNQVLPDY
LKALLSIVPQGKASEQQLQQIARLAALQHRAKDSIYLPTVREAQECVPPPFYSKQNPQLW
LNVTTQHMQHVQPLNPHQARAQFLGLVSAFPMFGSSFFYIQSCSSASIQAPCVLAVNLNG
LHFLNKDTHEAVVHFPLKEIQSTRTQRPTSGSSYPYVDIMIGDLLNQRITQLQLERGLEL
CRVIAMHVENMLSVREKRLTLPPSEITLL
Download sequence
Identical sequences H3D1R8
99883.ENSTNIP00000014456 ENSTNIP00000002748 ENSTNIP00000014456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]