SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014462 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000014462
Domain Number - Region: 49-140
Classification Level Classification E-value
Superfamily Prefoldin 0.00131
Family Prefoldin 0.013
Further Details:      
 
Domain Number - Region: 191-261
Classification Level Classification E-value
Superfamily Prefoldin 0.0188
Family Prefoldin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014462   Gene: ENSTNIG00000011512   Transcript: ENSTNIT00000014661
Sequence length 467
Comment pep:known_by_projection chromosome:TETRAODON8:2:4196343:4201091:1 gene:ENSTNIG00000011512 transcript:ENSTNIT00000014661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSGAMEEFVTEEEEPWYDQQDLEQDLHLAAELGKTLLERNKELEDSLQQMYITNEEQV
QEIEYLSKQLDVLREMNEQHAKVYEQLDGTARELESTNHTLVMDSKASQQKIQMLTGTID
TLQNQVRSLSDQVEQLRSMEQLRVRREKRERRKTIHSFPCLRELCTAPRYEDEFVVGRAE
SFTIDVKPQPFEEENQHLREAVSALRAAVRTERGRREGVEKECTLLLAEFSRLQTRVQDA
ESCQERVRELEDELQELQQLRRARTFLLGGEDDGVAETGGGVREDKEGGVAIQGEALPES
TPVRKSCSDTALNAIVARDASGRRRGSYALHANSVRRRGMSILREVDEQYHALLEKYEEL
LGKCRRHEENLCHAGVQTSRPVSRDPSMKDCAVGPTPAPPPTPVQSPSTPEAIESISKQV
EAVDKRLGQNTPEYKALFKEIFSRIQKTKMDIKATKAAKATKSDYTF
Download sequence
Identical sequences H3D1S4
99883.ENSTNIP00000014462 ENSTNIP00000014462 ENSTNIP00000014462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]