SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014464 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014464
Domain Number 1 Region: 4-247
Classification Level Classification E-value
Superfamily vWA-like 6.67e-69
Family Integrin A (or I) domain 0.00000141
Further Details:      
 
Domain Number 2 Region: 1021-1204
Classification Level Classification E-value
Superfamily Fibronectin type III 7.54e-39
Family Fibronectin type III 0.0000333
Further Details:      
 
Domain Number 3 Region: 1354-1555
Classification Level Classification E-value
Superfamily Fibronectin type III 5.43e-33
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 4 Region: 878-997
Classification Level Classification E-value
Superfamily CalX-like 8.63e-17
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 5 Region: 503-583
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.00000000000000131
Family Integrin beta tail domain 0.0035
Further Details:      
 
Domain Number 6 Region: 418-456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Integrin beta EGF-like domains 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014464
Domain Number - Region: 460-489
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000614
Family Integrin beta EGF-like domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014464   Gene: ENSTNIG00000011514   Transcript: ENSTNIT00000014663
Sequence length 1650
Comment pep:known_by_projection chromosome:TETRAODON8:2:4151449:4163378:-1 gene:ENSTNIG00000011514 transcript:ENSTNIT00000014663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAPTKGPLDLYILMDFSNSMADDLDNLKRMGNELATLVEQLSDDYTIGFGKFVDKVIEPQ
TDMRPEKLKKPWPDSDPPFSFQNVIKLTNDLNFFTAKLNDETISGNLDAPEGGFDAILQA
AVCGEKIGWRSDSTHLLVFSTESAFHYETDGVNVLSGILKRNDEQCHLDSAGKYTEDIHQ
DYPSIPTLVRLLGKHNIIPIFAVTNHSYTYYQKLKEYFPIAEVGLLQEDSSNILQVMETA
FKSIRSKMSIRAENRPKAFEAQFLSAGGKLSEYGDFDFTPGAIGKFKMRLKAQRTIDDTP
VCDAAQAEKYGTMRVKPTTFTKAVNVNADVLCPACDCEKIRVENAPRCHGNGRLVCGKCE
CYSGWLSTFCNCSASAALVTGQCIGPDMKEPCSGRGDCMECGTCVCYNPEQFEGPFCEYD
KTQCQRYGGFLCNDRGSCVMGKCACTEGWEGNACECPKSKQTCLDSKGGICNGRGKCVCG
LCECPNSGIELTSTCEPNFAQLGACEATRSCVQCQAWKTGEKKDKKDCDTCPFTVVMVDE
LKESDKVLDSCSFRDEDDDCTYHYTVENPKDKDLEVQVLKKKATPLDCPPASLLWLLPLL
LFLLLLLALFLLCCWKYCAGCKPCCQGCLALLPCCRRGRTVGWKEDEYLFRQSLLTSDHL
DTPMVRSGPPKGTDVVRWRVTDNVHRGLNHPQAVAKPNPKEMIPFPLSVRLDKLFFDNLA
RPESKEAEQLRSEVADNLNELYKQIPGAQKVQKTSFRMQRNAGKRQDYTIADTVLSAPRS
SFPDIVKLTEKNVQSGRMNNLKVVPGYYTIETDRATEAMGAIEFQEGVESLDVHVPLFVK
EEDDDKKKLQLEAVDVPLGIAKIAKRFVNITIIKDRANSIFSFPQPAYTYSRRDGVINIP
VSREIIEDGRTQVTYRTRDLTAKDKLDYVTVEGDLTYLPGETQKNVSVRLLELGEKDGLL
EDKQPKQFVMDLSNPLVGAKLGRYQRTTITIADQPGPEISQKQQKGYVSPKATGPGGLLY
APSNPQAKATGPRSIQLNWEPPPGNPMGYKVKYWIYGDPEKDAPVLDVKSPRADLTNLYP
YCDYEMRVCAYNENGDGYDTDIVTCQTPEDAPGKPGRLAFNVISPTVTQLSWAEPAETNG
NITAYEVIYTPIDDELKPVGAPKKVQIDNAKKRMLLIENLQNAQTYQYKVRAKNSVGWGP
FRDASINLASQPNRPLSIPIIPDIPIVDAEAGDEYDSYLMYSNEVLRSPTSSKSPSVSGD
ASSSPMSTLSSNYRAAGGSYNTEVTTTYLSGPVFHLAAGSSHRPNVSGGLHTSEVTMRKR
SENRVYTDENVRDSIVMGDLSSNFPDFDARLSPGVPDTPSRLVFSALGPTALKVSWQEPH
CERDIMGYCVIYQLLSGGEVKRINVTNPAENSVIIQDLLPNQSYLFKVKAQSQEGWGPER
EGVITIESAVDPRSPLCPMPGSPFTLSTPSAPGPLIFTALSPESLQLSWEKPRKPNGEIR
GYVVTCEQLHGGGDVRTFQVHGNSAETSLTVPDLVENVPYKFKVQARTTEGFGPEREGII
TIESQDGSALSQYNSQSMGRRDVFHMPTEVNTRTNVSHTVVNDPFHSEGMMVTTQRTETS
GMVTHQITKEVVQRSVVGGTTVTKKMFYET
Download sequence
Identical sequences H3D1S6
ENSTNIP00000014464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]