SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014489 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014489
Domain Number 1 Region: 135-244
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-35
Family Spermadhesin, CUB domain 0.0004
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.6e-31
Family Link domain 0.00000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014489   Gene: ENSTNIG00000011539   Transcript: ENSTNIT00000014688
Sequence length 244
Comment pep:known_by_projection chromosome:TETRAODON8:2:9138117:9144770:1 gene:ENSTNIG00000011539 transcript:ENSTNIT00000014688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILALLWTLGLLLQEAQAWSYKNGIFHNSIWLEQAAGVYHRESRKGRYQLTYKEAKAVCKY
EGGKLATYKQLEAARQIGRFHVCAAGWFGSGRVGYPIVKAGANCGFGKVGIIDYGYRLNK
SEKWDVYCYNPDTKECGGVLTDQQRIIQSPGFPEEYQDEQICYWHIRVRLGQKIHLQFQE
FDVEDDTGCLADYLEVYDSYDDVSGFAGRFCGDVLPDDIISTGNVMTLKFLSDSSVTAGR
FQAR
Download sequence
Identical sequences H3D1V1
ENSTNIP00000014489 99883.ENSTNIP00000014489 ENSTNIP00000014489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]