SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014511 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014511
Domain Number 1 Region: 302-534
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.05e-20
Family Extended AAA-ATPase domain 0.06
Further Details:      
 
Domain Number 2 Region: 1255-1432
Classification Level Classification E-value
Superfamily vWA-like 0.000000271
Family Integrin A (or I) domain 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014511
Domain Number - Region: 9-80,108-219
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000399
Family ABC transporter ATPase domain-like 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014511   Gene: ENSTNIG00000011561   Transcript: ENSTNIT00000014710
Sequence length 1442
Comment pep:known_by_projection chromosome:TETRAODON8:2:8901100:8912830:-1 gene:ENSTNIG00000011561 transcript:ENSTNIT00000014710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GYSIEPVMLYQDMTARDLLQQRYTLPNGDTAWRPSPLVSAAIEGKLLLDGIHRVNQGTLA
VLSQFSRLLHDRELDLFDGTRLMRWDRYQTLKEQLHFTDQQLQERSILPIHPSFRVLALA
EPPVAGASPSSKNSQQWLNAELLPMFLYHTVTPLIKAEELDLILGLTPDVPAEAVEKLLH
LKHNLRKANDPTAQSLASSLSTRQLLRICHRLSRYPNESITHAVNKACLARFLPRLARAA
LERSLDSSSIHDAAESDEHVDLSSLLGKVKDGVLTVGSVSAPVYNPGVKIKVPDVLFFNN
PQHLKVMEEMLKDFLLGEHLLLVGNQGVGKNKIVDRFLQLLNRPREYLQLHRDTTVQTLT
VQPSVQNGIITYEDSPLVKAAKLGHILVVDEADKAPTNVTCILKTLVESKEMILADGRRI
ISDPHEAEGRPNTIVLHPDFRMIVLANRPGFPFLGNDFFGAMGDIFSCHSVDNPKPTAEL
SMLKQYGPDVPDATLRKLVAVFGELRSMADQGTINYPYSVREVVSIVKHLQKFPHEGLAS
VVSNVFDFDSYNKDMREVLYEVLHKHGIPVGAKPTSVKLAKELPLPQISMTGRWTTNHSS
NDGRTLLCPTERHSAEIKGPVFLRVQPYPCHRQESRALTFAEEKAHWQIPMNETNIICHV
NARDDVLYVATCNPVALYSMREHGDTIQYIDLYDVFPKTISGVWQPCVTIAPLGGPLDGQ
VVLHEEQTNTVLHVDSVTGAVRRLMLSPHTDQPHTKASSWWTSKEQQGGYKMCHEFAHKN
WLLFYKENSNQLDMLDVLKAQVHSISLPIKMKSVFLVAEDRWLLLETDTNKKFLMTKATG
ESEAYQLLSISEDNLSQPVPTTSTADVSIPDMVSCEQLPNENLSIAMGQKIAFPNRLLAD
AGSFVRIIVGFPDAVSPIEVYSFTRPVSLTSVKNNESGPHMFLRGGLRSTSPRRQNCASL
LSANQVIRALPPSKVPLKDVYPKDVTPPMTAGYLEVVDLNFKKVKYIPIPRSNSVSPYTN
WLSKMSETDVVMAVLGSGAVVTVDMGGHARLWETGYESLQRSLTEWKNMIGTESPVQITI
ERESGQDVTAPKHGKVDPSNAPHIGGNQWAGGTGGRDTAGLGGKGGPYRLDSGHTVYQVS
QAEKDAVPEEVRRAAREMAEKAFKDRLREIDMSEYDAATYERFSNAVQRQVQSLRIILES
LQAKGKERQWLKHQATGELDDAKIIDGLTGEKTIYKRRGELEPEVGSPYEKAKRLRVLTD
VSGSMYRFNGVDGRLERSMEAVCMVMEALEGFEQKFKYDIVGHSGDSHNIELVRADKIPK
NNKERLKVLKIMHAHSQFCMSGDYTLEATDASIKELAQEEADEHFLVVLSDANLERYGIR
PERFANVLTSDPEVNAFVIFIGSLGDQAERLQKTLPAGRTFVVMDTQKIPQTLQQIFTST
VL
Download sequence
Identical sequences H3D1X3
99883.ENSTNIP00000014511 ENSTNIP00000014511 ENSTNIP00000014511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]