SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014525 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014525
Domain Number 1 Region: 127-374
Classification Level Classification E-value
Superfamily vWA-like 4e-83
Family Integrin A (or I) domain 0.00000000535
Further Details:      
 
Domain Number 2 Region: 370-459
Classification Level Classification E-value
Superfamily Integrin domains 1.83e-29
Family Integrin domains 0.0000133
Further Details:      
 
Domain Number 3 Region: 630-714
Classification Level Classification E-value
Superfamily Integrin beta tail domain 3.92e-24
Family Integrin beta tail domain 0.0000293
Further Details:      
 
Domain Number 4 Region: 19-77
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000241
Family Plexin repeat 0.00023
Further Details:      
 
Domain Number 5 Region: 546-584
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000307
Family Integrin beta EGF-like domains 0.0094
Further Details:      
 
Domain Number 6 Region: 588-629
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000419
Family Integrin beta EGF-like domains 0.001
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014525
Domain Number - Region: 516-546
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0134
Family Integrin beta EGF-like domains 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014525   Gene: ENSTNIG00000011575   Transcript: ENSTNIT00000014724
Sequence length 787
Comment pep:known_by_projection chromosome:TETRAODON8:2:8772832:8782485:1 gene:ENSTNIG00000011575 transcript:ENSTNIT00000014724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSLILFLLYSCFIRLVPGSNVCTTRGASTCKQCLAVHPSCAWCFQEDFGLGVSSSPRCDL
KRNLVAAGCAASAVESPTSKLQVVEDRPLSNKATLATQDITQIKPQRLHINLRPDDAKRF
TVKVRQVEDYPVDLYYLMDLSYSMNDDLFRLRTLGKGLAEAMSRTTSNLRMGFGAFVDKP
LSPYMYISPKEAVKNPCYSINMTCLPQFGYKHVLTLTEEVGRFTEEVKKQMVSRNRDAPE
GGFDAIIQAAVCKEQIGWRPGASHLLIFTSDAKTHVALDGRLAGIVQPNDGKCHLNSENM
YSMSTTMDYPSLALITEKMSENNINLIFAVTNPVVRLYQNYSELIPGTTVGTLNNDSGNV
IQLILKAYAKIRSKVELELQGVPEELALSFNASCLNGELIPGLKSCSGLKIGDTVSFTVE
ARARGCPKEKKKTFVIKPVGFKDTLSITVTFECDCKCQARAQPSSPKCNHGNGTYECGIC
MCHPGRLGPHCECAEGDYDPTEQDSCSGPTGSGGRASVCSGRGDCVCGQCVCHSSDFGKV
WGKLCECDDFNCLHYKGELCSGHGVCNCGFCQCAPDWQGDNCNCSRRTDTCMSGMGLLCS
GRGQCVCGACECTQPGAYGATCDKCPTCPDACTMKKECVECKHFKRGKLFEGSTCSRICK
DEIVLVDELGSEVTNAVNCSYKDEDDCVQRFQYYEEASGKSILYVVKEPDCPKGPDILVV
LLSVAGAILFLGLAALLIWKLLITIHDRREFAKFEEERARAKWDTGHNPLYKGATSTFTN
ITFRGKD
Download sequence
Identical sequences H3D1Y7
ENSTNIP00000014525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]