SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014581 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000014581
Domain Number - Region: 39-158
Classification Level Classification E-value
Superfamily E set domains 0.00147
Family Arrestin/Vps26-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014581   Gene: ENSTNIG00000011629   Transcript: ENSTNIT00000014780
Sequence length 336
Comment pep:known_by_projection chromosome:TETRAODON8:7:1224802:1227084:-1 gene:ENSTNIG00000011629 transcript:ENSTNIT00000014780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIFGFGQSAEIDIVLNDAESRKKAEHKSEDGRKDRYFLFYDGETVSGKVNVTLKYPGKR
LEHNGIKIEFFGQIELYYDRGNHHEFVSLVKDLARPGELTQSQTFDFEFTHVEKPYESYT
GQNVRLRYVLRATVGRRLSDITKELDVVVHTLSSYPEINSSIKMEVGIEDCLHIEFEYNK
SKYHLKDVIVGKIYFVLVRIKIRHMEIDIIKRESTGSGPNVYHENETIAKYEIMDGAPVR
GESIPIRLFLAGYELTPTMKDINKKFTVRYYLNLVLIDEEDRRYFKQQEIILWRKGDVAR
KSMPHQAAVASQRFGDARQSEEAQHPEDQPEVNCSR
Download sequence
Identical sequences H3D243
ENSTNIP00000014581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]