SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014598 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014598
Domain Number 1 Region: 16-135
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.58e-27
Family Ankyrin repeat 0.00097
Further Details:      
 
Domain Number 2 Region: 317-362
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.00000000000654
Family MYND zinc finger 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014598   Gene: ENSTNIG00000011646   Transcript: ENSTNIT00000014797
Sequence length 380
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:29229854:29233912:1 gene:ENSTNIG00000011646 transcript:ENSTNIT00000014797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVMSVKGDLSSSEKELLDVIATGNVQEASRLLGCKDVRVNCLDEYGMTPLMHAAYKGKTD
MCKLLLQHGADVNCNQHEHGYTALMFAGLSGKTDITWMMLDAGAETDVVNSVGRTAAQMA
AFVGQHDCVTVINNYFSRARLDYYTKPQGLEKEPKLPPKLAGPLHKIIMGTNLNPVKMVM
LVEENPLLVEAEALDKCRRVMELICEKCIKQQDMNEVLAMKMHYISCVLAKCAAFLKERD
DRLDGLIKSLLKGRDSDGFPVFQEKFVRECIRKFPFCDTTLLQQLVRSIAPVEIGNDPTA
LSVLTQAITGQVGFMDAEFCTTCGEKGAQKRCSACKMVVYCEKACQKLHWFTHKKVCKKL
QEQREKRELEAEKLRVQQSK
Download sequence
Identical sequences H3D260
ENSTNIP00000014598 ENSTNIP00000014598 99883.ENSTNIP00000014598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]