SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000014643 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000014643
Domain Number 1 Region: 489-558,612-648
Classification Level Classification E-value
Superfamily Second domain of FERM 1.74e-18
Family Second domain of FERM 0.0077
Further Details:      
 
Domain Number 2 Region: 92-194
Classification Level Classification E-value
Superfamily PH domain-like 1.51e-16
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000014643
Domain Number - Region: 391-463
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000827
Family First domain of FERM 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000014643   Gene: ENSTNIG00000011692   Transcript: ENSTNIT00000014843
Sequence length 697
Comment pep:known_by_projection chromosome:TETRAODON8:3:12838538:12854507:-1 gene:ENSTNIG00000011692 transcript:ENSTNIT00000014843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLHGLCWLLCCRQGFSLLGRDYGEKEEEESFELRNKEDLTPSGRSPAEVTVSQPTHTAN
GSNGLLRVWVSEEMKSLVLEKNKVGLDEEPELLVKGWLLLEVRGNWIKQRRYWFVLSQDS
LDYYSGSEKGARRLGTLVLTSLCSVIWPDKQKYKETGFWNITVFGRKHCYRLYTRHFNEA
VHWACAIQKIIDTKAPVDTPTQLLIRDIEENKFHPEVVEHIYQHNPILKYTQGPLYAPLL
PFPYGSLEHTYHSGKGYGSVREEAVKLFNCLQQLESSREPVPIIQGVLQTCLDLRPLRDE
VYCQLVKQTSHTPAPYTAAHLRYWQLLTCMSCTFLPGPSVLKYLRFHLKRVQSQNPESEM
DNYASFINEALDKTKCRECVPCWEEIQTLMNREKMPCTVHYPGPGSCQLYISSHTTANEV
ARRMQEKLGLQESKNTFALYKQNSVWEQPLAGGALIADVLTRFVNLNSKDSEAKSQWKLC
FKLYCLLDTESISVDSIEYLFLFEQCHEMVVRGQLPACEEDLQTLAALRLQFLMGDFSTH
APCPPLDELFPNHMLEARVLVSLSPCQVAAQGCHSTQRFAPGLLAGALWSHTATAAHKQK
MKQDIHLRSRLKEEAAAVMGSILERWRGLAGYGCRDSIAAYLTIARQWSGFGCTLYEVDF
YIESCGWASLLHLCPCIGKERPKRWSLSPTARSVPTA
Download sequence
Identical sequences H3D2A5
ENSTNIP00000014643 99883.ENSTNIP00000014643 ENSTNIP00000014643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]